(data stored in ACNUC30630 zone)

EMBL: CP001275.PE448

CP001275.PE448       Location/Qualifiers
FT   CDS_pept        complement(453510..455270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0459"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM PF02540; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06323"
FT                   /db_xref="GOA:B9KYB4"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB4"
FT                   /protein_id="ACM06323.1"
FT                   /translation="MVEEMTRDTWRIALAQIDPTVGDFSGNVRLIRERAREAAQLGAHI
FT                   VAFPELVITGYPPEDLLLKVSFIDAARRALHLLLDAIPDRVLIVGVPWVESGILYNGAA
FT                   ILARGEIVAVVPKHHLPTYGVFDEDRYFARGSHTFRFLWGNLRFGVTICEDIWYPIGPA
FT                   SSLATRGIDLLVNINGSPYHRGKWIQRQVMLQTRAADAGCYLAYVNMVGGQDELVFDGN
FT                   SIVLDPNGTILARGTSFEEDLIVVDLPITRVLSSWLHDPRRRWLARAESQPALPVVDRE
FT                   IPLPVPGEQLPPLPESVQRPRTPLEGVAEVYQALVTGVRDYVRKTGFRTAVIGLSGGID
FT                   SSLTACIAADALGPENVTGLSMPSRYSSRHSIEDAEELARNLGIRFLIVPIEPVHRVFR
FT                   EVLAPLGNQPEEPDVADENLQARIRGTILMTYSNRFGPIVLTTGNKSEMACGYATLYGD
FT                   MAGGFAVLKDVPKLLVYQLARYRNSISPVIPERVFVKPPSAELRPNQKDVDTLPPFEIL
FT                   DPLLELYVEQDLSREELIRHGFDPEIVDRVIMMVDRAEYKRRQAAPGVKLTPRAFGRDR
FT                   RLPIANWFHG"
     gtggtcgagg agatgacgcg cgacacgtgg cggatcgcgc tcgcgcagat cgatccgaca        60
     gtcggcgact tctcgggcaa cgtccgcctc atccgcgagc gcgcccggga agcggcccaa       120
     ctcggtgctc atatcgttgc ttttcccgaa ctcgtcatca ccggttatcc tccagaagat       180
     ctgctcctca aggtcagctt catcgacgcg gctcgccgcg cgcttcatct gctcctcgac       240
     gccataccgg atcgcgtcct gatcgtcggt gtaccatggg tcgagagcgg catcctctat       300
     aatggggccg ctatcctcgc ccgtggtgag atcgtcgccg ttgtccccaa acaccatctg       360
     ccgacctatg gtgtcttcga cgaggatcgc tatttcgcac gcggaagtca cacgtttcgg       420
     tttctctggg gcaatcttcg gttcggcgtc accatctgcg aagatatctg gtacccgatc       480
     ggaccagcca gcagcctggc caccagaggg atcgacttgc tcgtcaacat caatggttcg       540
     ccgtaccatc gcgggaagtg gatacagcgc caggtgatgc tccaaacccg tgccgccgat       600
     gccggctgtt atctggccta cgtcaacatg gtcggcgggc aggacgaact ggtcttcgac       660
     ggcaacagca tcgtgctcga ccccaacggg acgatcctcg cccgtggaac atccttcgaa       720
     gaggatctca ttgtcgtcga ccttccgatc acgcgcgtgc tttccagctg gctgcacgac       780
     ccgcgccgac gctggctcgc ccgagcagag tcgcaacctg cgcttcctgt ggtcgatcgc       840
     gagattcccc tacccgtccc tggggaacag cttccaccct tgccggagag cgtccagcgg       900
     ccacgcacgc cgctcgaggg agtcgcggaa gtctaccagg ctctcgtcac cggtgttcgc       960
     gactatgtgc gcaaaaccgg attccgcacc gccgtgatcg gcttatcggg agggatcgat      1020
     tcgtctctga cagcatgcat cgccgcggac gccctcggtc cggagaatgt cactggcctc      1080
     tcgatgccca gccgatactc ttcgcgccac agcatcgagg atgccgaaga gctggcccgc      1140
     aacctcggta ttcgctttct gatcgtaccc atcgaaccgg tccatcgtgt tttccgcgaa      1200
     gtgctggcac cgctcggtaa ccagccagaa gagccggatg tggcagacga aaatctgcaa      1260
     gcgcgtatcc gcggcacgat tctcatgacg tattccaatc gtttcgggcc gatcgtgctc      1320
     accacgggga acaagtccga aatggcctgt ggctatgcga cgctttacgg cgatatggcc      1380
     ggcggcttcg ccgtcctcaa agatgtcccg aaactcctcg tctaccaact cgcacgctat      1440
     cgcaacagca tctcgccggt cattcccgag cgtgtcttcg tcaagccacc gtctgcggaa      1500
     cttcgcccga atcagaagga cgtcgatacg cttccgccct tcgaaattct cgatccactc      1560
     ctggagctct acgtcgagca ggatctcagc cgagaggaat tgatccggca tggcttcgat      1620
     cctgaaatcg tcgaccgcgt catcatgatg gtggatcgcg ccgagtacaa acgtcgacaa      1680
     gcagcaccag gggtcaagct gacgccgcgc gccttcggac gcgatcgccg cttacccatt      1740
     gccaactggt tccatggctg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page