(data stored in ACNUC30630 zone)

EMBL: CP001275.PE48

CP001275.PE48        Location/Qualifiers
FT   CDS_pept        59015..60220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04893"
FT                   /db_xref="UniProtKB/TrEMBL:B9L268"
FT                   /protein_id="ACM04893.1"
FT                   /translation="MLSSSGRNARATLASCAAFARTEAAVSRQADALGLFAQLLDERGE
FT                   CFGCRTGIPAHRSDVAHLLGDGGERRCDLLGRGRMPVDDLRNTLQFSDEFVLRSGHRFA
FT                   GSSDRTDLVTDLPCVLGESVQRGFCLARQGDSFFDLAHARSRFSDHVIERVQDLIDQSA
FT                   DLLGGRAGAFGELAHLFGHDGKALASFPCSCSLDRGIEGEEIGLSGDLVDRLDHRGDPS
FT                   GTIRHLLDARADASHPLTGVPERGDGTAHRFAAGGRFGDVTLARSDSAACRVGDSLDTG
FT                   SQRLRQLGQAVQCLLLGAGAAREFGDGTLDLVDRPLGCAEEVALAYGAAGNRLHGLGRF
FT                   GSGMGQVLAALAQLVADSGGQGSCALEAGDRLAHRLFERPVQVGEIVLRSLGRDAREIE
FT                   PD"
     gtgctctcct cgagcgggcg gaacgcgcgg gccacgctgg ccagttgcgc ggcgtttgcg        60
     cggaccgagg cggccgtcag ccgtcaggcg gacgcgctcg gcctcttcgc ccagttgctc       120
     gacgagcgag gcgagtgctt cggctgccgc actggtatcc cggctcaccg tagcgacgtc       180
     gcgcacctgc tgggtgacgg tggtgagcgt cgatgcgatc tcctcggtcg cggccgtatg       240
     cccgtcgacg acctgcgcaa cacgctccag ttctccgacg agttcgtcct tcgctcggga       300
     catcgcttcg ctggctcgtc cgatcgcact gatcttgtca ccgatctgcc gtgcgttctc       360
     ggtgagtcgg tgcagcgcgg cttctgcctc gctcgccagg gcgactcctt cttcgacctc       420
     gcgcatgccc gaagtcgctt cagcgaccat gtcatcgagc gtgtgcagga tctcatcgac       480
     caatccgcgg atctcctggg tggtcgagct ggagcgttcg gcgagcttgc gcacctcttc       540
     ggccacgacg gcaaagccct tgccagcttc ccctgctcgt gcagcctcga tcgcggcatt       600
     gagggcgagg agattggtct gtcgggcgat ctcgtcgacc gcctcgacca tcgcggtgat       660
     ccgtcgggaa cgattcgcca tctcctcgac gcgcgtgccg atgcgtcgca tcccctcacc       720
     ggagtgccgg agcgaggcga tggcacggcg caccgtttcg ctgccggtgg tcgcttcggc       780
     gacgttacgc tcgctcgcag cgattccgcc gcgtgccgcg tcggtgacag cttggatact       840
     ggcagccagc gtctgcgcca gctgggccag gcggtgcaat gcttgctgct gggcgctggc       900
     gccgcgcgcg agttcggtga tggcacgctg gacctcgtcg atcgcccgct cggctgcgct       960
     gaggaggtcg ctttggcgta cggcgccgcg ggaaaccgat tgcacggcct gggtcgcttc      1020
     ggcagcggca tgggacaagt gctcgccgct ctcgctcagt tggtcgctga tagtggcggc      1080
     cagggcagct gtgcgttgga ggccggtgat cgcttggcgc accgcctctt tgagcggccg      1140
     gtacaagtcg gagagatcgt cttgcggtcg ctcggtcgtg acgctcgaga gatcgaaccc      1200
     gactga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page