(data stored in ACNUC30630 zone)

EMBL: CP001275.PE480

CP001275.PE480       Location/Qualifiers
FT   CDS_pept        486861..487697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0491"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="2.7.1.66"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06101"
FT                   /db_xref="GOA:B9KYE6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYE6"
FT                   /protein_id="ACM06101.1"
FT                   /translation="MNVWQAAVLGIVQGTTEFLPISSSAHLIVLPWLFDWPEPGLAFNV
FT                   ALHLGTLSAVLAYFWRDLIQIGRAWFAGLIRLRPLEDSASRLGWAVIIGSLPAGLAGFF
FT                   LNDVIDHFFHSGGGGDTAIVFTSLLLIVLGFVLWLAERYGTRWRSLGELGLRDGLVVGL
FT                   AQALALLPGVSRSGSTITASLFLGFARPAAARFSFILGIPAIAGAGLLETLKLVETGLP
FT                   AEQRVLFVTGVASAAITGFLAIAFLLRFLQRYSTSIFIVYRIALGLVLLLVVSFAR"
     atgaatgttt ggcaagcggc cgtgctcggt atcgttcaag gaacgaccga gtttctgcct        60
     atcagtagtt ctgcccatct catcgtgcta ccatggctct ttgattggcc ggaaccgggg       120
     ctggccttca acgtcgcgct gcacctcgga acgttgtctg cagttctcgc ctacttctgg       180
     cgtgatctga ttcagatcgg gcgggcgtgg ttcgcggggc tcatccgtct ccgcccactc       240
     gaggactctg cgtcacgttt gggctgggca gtgatcatcg gatcgcttcc ggctggtctg       300
     gctggattct ttctcaatga tgtcatcgat catttctttc attccggcgg cggaggcgat       360
     accgcgatcg tgttcacgag tcttctcctg atcgtgctcg ggtttgtcct ctggttggct       420
     gaacgctacg gaactcgatg gcggtcgctc ggcgaactcg gtttacgaga tgggctggtt       480
     gtgggtcttg cccaggccct ggctcttctt ccgggcgttt cccgctctgg tagcaccatc       540
     actgcaagcc tctttctcgg tttcgctcgc ccggcagccg ctcgcttttc cttcatcttg       600
     gggattccgg cgatcgccgg tgccggactg ctcgaaacac taaaactggt cgaaaccggt       660
     cttcctgcgg agcagcgagt cctgttcgtg accggagttg ccagcgcggc gatcaccggg       720
     tttctcgcca tcgcttttct cctgcgcttc ctgcagcgct acagtacgag catcttcatc       780
     gtgtaccgca tcgcactggg cctcgtgctc ttgctcgtcg tttcgttcgc tcgctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page