(data stored in ACNUC30630 zone)

EMBL: CP001275.PE482

CP001275.PE482       Location/Qualifiers
FT   CDS_pept        complement(489566..489910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0493"
FT                   /product="protein csaA"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM TIGR02222"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05839"
FT                   /db_xref="GOA:B9KYE8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE8"
FT                   /protein_id="ACM05839.1"
FT                   /translation="MEAKPPIELADFQRVDLRVGRIVAVEEFPEARRPSYKLTIDFGPL
FT                   GVKRSSAAIRPWYAPEDLIGRLIIAVVNLPVRRVAGFPSEVLVLGAIQPDGRVILLQPD
FT                   QPTDPGNPIA"
     atggaagcca aaccgccgat cgagctcgcc gattttcaac gcgtcgatct gcgtgtcggg        60
     cgaatcgttg ccgtggagga gtttccggag gcacgccgac catcgtacaa gctgaccatc       120
     gatttcgggc cgctgggggt caagcgctcc tcggcagcca tccgtccctg gtacgcgccc       180
     gaagatctca tcggccggct gatcatcgcg gtcgtcaacc tccccgtccg acgggtcgcc       240
     ggtttcccct cggaagtgct tgtcctgggc gctatccagc cggatggacg ggtcatcttg       300
     ctccagccag accaaccaac cgatccgggc aacccgatcg cctag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page