(data stored in ACNUC30630 zone)

EMBL: CP001275.PE50

CP001275.PE50        Location/Qualifiers
FT   CDS_pept        61007..62080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0052"
FT                   /product="tyrosine recombinase xerC"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06054"
FT                   /db_xref="GOA:B9L270"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:B9L270"
FT                   /protein_id="ACM06054.1"
FT                   /translation="MEGNFSLTRTIDEWLAGRPAATRRAYAHDVREFLAALGGELAQLD
FT                   ETALRRWLATFEHRRLARATVRRKLAAVRSFLRYLAERGYLERDLSSVVPAAFGKPPDQ
FT                   TPRVHATERGRLLATALQLADPRLQLLLWLAGCGCPLPVIARLRWRDLEQWNGQGIAFC
FT                   HDERERAYRCVIPGLIWRGLQSLAETQAGDALVFAHPDGRPVSPQELAETIGWLLDEAA
FT                   PELATDHRDDDRLLTLSEVAQRLGLPETTIRYYRDRFAPYLPTVGRGRSRRYSPQAVER
FT                   LRWIIEQLHAGVSPVEIEAQLGGKTNAFASTEDEHRLIESVERLSQRIAELTVSLQLVA
FT                   KALLQQEGWSPREPGTD"
     gtggagggaa acttttcgct caccaggacg atcgacgagt ggcttgccgg tcgaccagcg        60
     gctacccgcc gtgcgtatgc ccatgacgtg cgggaattcc tcgctgcgtt agggggcgag       120
     ctggcgcagc tcgacgagac ggcgctccgg cgatggctgg cgacgttcga gcatcgtcgg       180
     ctggcccgag cgacggtccg gcgcaagctc gcggctgtcc gctctttcct ccgctatctg       240
     gctgaacgcg gctacctcga gcgagacctc agctcggtcg ttcccgcggc cttcgggaag       300
     cctcctgacc agacaccacg ggtgcacgcg accgagcgtg gtcgcctgct cgcgactgcg       360
     ctccaactgg ctgacccgcg cctgcagctc ttgctctggt tggctggctg tggttgcccg       420
     ctcccggtga tcgcgcgact ccgctggcgt gatctcgaac agtggaacgg gcaagggatc       480
     gcgttctgcc acgacgaacg cgagcgagcg taccggtgtg tcattcccgg cctgatctgg       540
     cgggggcttc agtcgctcgc ggaaacgcaa gcaggcgatg cgctcgtctt cgctcatccc       600
     gatggtcgtc cggtgtcacc ccaagagctc gcggagacga tcggttggct gctggacgag       660
     gcagcccccg aactagccac cgatcaccgg gacgacgacc ggctcctgac actcagcgag       720
     gtggcgcagc gactgggact tcccgaaacg acgatccgct actaccgtga tcgcttcgct       780
     ccctatctcc cgaccgtcgg tcgcggtcga tcgcgccgct attcaccgca agcggtcgag       840
     cgactccgtt ggatcatcga acaactccac gccggcgtct ctccggtgga gatcgaagcg       900
     caactcggcg gaaagacgaa cgcgttcgcg tccacggagg acgagcatcg cctcatcgag       960
     tctgtcgaac gcctcagcca acggatcgcc gaattgacgg tgagtttgca gctcgtcgcc      1020
     aaggcgctcc tgcagcagga gggatggtct ccccgcgagc cagggacgga ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page