(data stored in ACNUC30630 zone)

EMBL: CP001275.PE508

CP001275.PE508       Location/Qualifiers
FT   CDS_pept        complement(516833..518038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0520"
FT                   /product="spermidine/putrescine-binding periplasmic protein
FT                   precursor"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04774"
FT                   /db_xref="GOA:B9KYH4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH4"
FT                   /protein_id="ACM04774.1"
FT                   /translation="MNRPELIQRWIRDWQQGRLSRRELLRRVTLLGMSSFALANLLTAC
FT                   ARSQPTPTPASTEASPRVGAAIPDYIDRSKLDKELNFYNWSEYIDPDILTEFQETYGVK
FT                   VTMDTYASNEDLLAKLQGGATGYDVIVPSDYMVSIMINLGLLEPLDYSVIKTIANIDPE
FT                   NLKPYYDPDNTYSVPYMWGTSGYSYDTSVLGEDLASWKEVFEPRPEVRGKVVMLDDQRE
FT                   VIGAALMYLGYEINETSDDALAKAKQLLLTQKPYVLAYSSQNNDDLLVAGEALIAHIWT
FT                   GDALMSEQEKPTLRYVIPTEGCTVWQDNLCVPKTAPHKYTAMVFIDFLNRPDIAGRNAN
FT                   YIMYGSPNKAAREQGYIDQEVLNNPGVYPPPEVWKRLQWIKDVGEEGALKLDRLWTEIK
FT                   TG"
     atgaatcgac cggaactcat ccagcgatgg atccgcgatt ggcagcaggg tcggctctcg        60
     cgccgtgaac tcttgcggcg agtgacactg ctcggcatga gttcgttcgc gctcgccaac       120
     ttgctcactg cctgcgctcg atcgcagccg acgccgacac ccgcgtccac tgaggcatca       180
     ccgcgcgttg gggctgcaat ccctgactat atcgatcgca gcaagctgga caaggaactc       240
     aacttctaca actggtcgga gtacatcgat ccggacatcc tgaccgagtt ccaagagacc       300
     tatggcgtca aggtcacgat ggacacctac gcttccaacg aggatctact cgccaagctc       360
     caaggtggcg cgacgggcta cgacgttatc gttccctccg actacatggt cagcatcatg       420
     atcaacctcg gcctcctcga gccactcgac tactctgtca tcaagacgat cgcgaacatc       480
     gaccccgaga atctgaaacc gtactatgac cccgacaaca cctatagcgt gccgtacatg       540
     tggggtacct ccggttacag ctacgatacc agtgtgctcg gcgaagacct cgccagctgg       600
     aaagaagtgt tcgaaccacg acccgaggtg cgcggcaagg tggtcatgtt ggatgaccag       660
     cgcgaggtga tcggggccgc cctcatgtat ttgggctacg agatcaacga gaccagcgat       720
     gacgcactcg ctaaagcgaa gcaactactc ctcacgcaga agccgtacgt gctcgcctat       780
     tccagccaga acaacgatga cttgctcgtc gcgggcgaag cactgatcgc ccacatctgg       840
     accggcgatg cgctcatgag cgagcaagag aagccgaccc tccgctatgt catccctacc       900
     gaaggttgca cggtctggca ggacaacctt tgtgttccca agacggcccc gcacaagtac       960
     acggcgatgg tcttcatcga ctttctcaac cggcccgaca tcgctgggcg caacgccaac      1020
     tacatcatgt acgggagccc gaacaaagca gcccgagagc aaggctatat cgaccaagaa      1080
     gtgctcaaca atccgggtgt ttatccgcca ccggaggttt ggaagcgact tcaatggatc      1140
     aaggacgtcg gtgaagaggg cgctctcaag ctggatcgtc tctggacaga gatcaagacg      1200
     ggctga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page