(data stored in ACNUC30630 zone)

EMBL: CP001275.PE510

CP001275.PE510       Location/Qualifiers
FT   CDS_pept        complement(518911..519825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0522"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein potB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06030"
FT                   /db_xref="GOA:B9KYH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH6"
FT                   /protein_id="ACM06030.1"
FT                   /translation="MSAIDRVRVQERSLGWHERASERIRQSERVRALFLAGPGGLWLLL
FT                   FFLLPTAIVFAYSFARRGPYGAVAWAFTLENYARLFDWLYIRVFLMSVWLALLTTVICL
FT                   VIGYPFAFVIARSPRRWRNALLVLVLIPFWTNFLVRTYAIMLLLRADGLINNALQWLGL
FT                   IDRPLSLLFTPFAVVLGLVYGYLPFMILPIYASIEKFDFTLVEAAQDLGANAWHVFWRV
FT                   LLPLTLPGVLAGSILVFIPSVGAFVTPDLLGGGKVVMIANLINQQFLTVRHWPFGSAIS
FT                   FVLMAIVLAATMLYFRIGETRRI"
     atgagcgcca tcgaccgtgt acgagtccaa gagcgttccc tcggctggca cgagcgcgcc        60
     agtgagcgga tccggcaaag cgaaagagtg cgcgctctct tcctcgccgg gccaggcggt       120
     ttgtggctcc tcctgttctt cttgttaccg acagccatcg tgttcgccta cagtttcgct       180
     cgccgcggcc cctatggagc ggtagcctgg gctttcacgc tggagaacta cgcgcgcttg       240
     ttcgactggc tgtacattcg agtctttctc atgtcggttt ggctcgcctt gctcaccacg       300
     gtcatttgtc tcgtcatcgg ttatcccttc gccttcgtca tcgcccggag tccacgccgc       360
     tggcgcaacg cactcctcgt cctcgtcctg atcccgttct ggacgaactt tctggtgcgc       420
     acctatgcca tcatgctcct cttgcgcgct gacgggctca tcaacaacgc gctgcagtgg       480
     ctggggctga tcgatcgtcc tctctctctg ctcttcaccc ccttcgccgt cgtgctcggt       540
     ctcgtctacg gctatcttcc cttcatgatc ctaccgatct atgcatcgat cgagaagttc       600
     gacttcacgc tggtcgaggc tgcacaggat ctcggtgcga atgcgtggca cgtcttctgg       660
     cgcgtcctgc ttcctcttac gcttcctggt gttctcgctg gctcgattct cgtcttcatt       720
     ccgtcagtcg gtgccttcgt gacccctgac ttgctcgggg gcggcaaggt agtcatgatc       780
     gccaatctga tcaatcagca gttcctgacc gtgcgacact ggcccttcgg ttcagcgatt       840
     tcgttcgtct tgatggcgat cgttctcgca gcgaccatgc tctacttccg aatcggggag       900
     acgcggcgga tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page