(data stored in ACNUC30630 zone)

EMBL: CP001275.PE511

CP001275.PE511       Location/Qualifiers
FT   CDS_pept        complement(519844..521013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0523"
FT                   /product="ATP-binding component of putrescine transport
FT                   system"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05384"
FT                   /db_xref="GOA:B9KYH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH7"
FT                   /protein_id="ACM05384.1"
FT                   /translation="MTMTPTILAIETVCASGMGGMEPLERPIDVELLDVTKVFENGVVA
FT                   VDRVSLQIYQGEFFSLLGPSGCGKTTTLRMIAGFEHPSAGEVLIEGRRMGHTPPFRRNV
FT                   NTVFQNYALFPHMTVFDNVAFGLRMKRIPRDEIARRVREALHLVRLSGMEERYPRQLSG
FT                   GQQQRVALARALVNRPRVLLLDEPLGALDLKLRKEMQLELKHLQMTVGITFIYVTHDQE
FT                   EALTMSDRIAVMNAGRVLQVGTPMEIYERPASRFVADFIGESNFLRGTVQAASSAAATV
FT                   VIADRFPVEVPADRQLTVGQQVTVAVRPEKVRLVPIEAPGTNGLLHGRIEEVIYIGTDT
FT                   FYVVRVSDDTTIRVRSQNDRNRLDGGLLLPVGTPVSLTWATDAARILTE"
     atgaccatga cgccgacaat cctggcgatc gagacagtat gcgcgagcgg catgggaggg        60
     atggaaccgt tggagcgccc gatcgacgtc gaacttctcg atgtcaccaa ggttttcgag       120
     aatggcgtgg tcgcagtcga tagggtttcg ctccagatct atcagggaga gtttttctcc       180
     ctgttgggtc cttcgggctg cggaaaaacg accacgctac gcatgatcgc agggttcgag       240
     catccgagcg cgggcgaggt actcatcgag ggccgccgga tgggtcatac gcccccgttc       300
     cggcgtaacg tgaacaccgt tttccagaac tatgcgctct ttccccacat gacggtcttc       360
     gacaatgtgg ccttcggctt acgtatgaag cgcattccgc gcgacgaaat cgcccgtcga       420
     gttcgcgaag cactccacct ggtccgcttg agcggtatgg aggagcggta tccgcggcag       480
     ctctccggtg gacaacaaca gcgcgtggcc ttggcccgag ccctggtgaa ccggccgcgt       540
     gtcctcttgc tggacgagcc actcggagcg ctcgatctga agctgcgcaa agaaatgcaa       600
     ctggaactca aacacctcca gatgaccgtc ggtatcacct tcatttatgt cacgcacgat       660
     caagaagaag cgctcaccat gtcggaccgt atcgcggtga tgaatgccgg acgcgttctg       720
     caagtgggaa caccgatgga gatttacgag cgaccagcct cgcggttcgt cgccgacttc       780
     atcggcgaat cgaatttcct tcgtgggact gtccaggctg cgagttcggc cgcggccacc       840
     gttgtcatcg ctgatcgttt tcccgtcgag gttccggctg atcgccagct cacagtcggc       900
     cagcaagtca ccgttgccgt tcgccccgag aaggttcggc tcgttcccat cgaggctccg       960
     gggaccaacg ggctcctgca cgggcgaatc gaagaagtga tttacatcgg aaccgatacg      1020
     ttttacgtcg tccgggtgag cgatgacacg acgatccgcg tccgcagtca gaacgaccgc      1080
     aaccgcttgg acgggggact gctccttccc gtcgggactc ccgtatcgct cacttgggcg      1140
     accgatgcgg cacggatcct caccgagtag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page