(data stored in ACNUC30630 zone)

EMBL: CP001275.PE516

CP001275.PE516       Location/Qualifiers
FT   CDS_pept        526394..527350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0528"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05018"
FT                   /db_xref="GOA:B9KYI2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI2"
FT                   /protein_id="ACM05018.1"
FT                   /translation="MPKGYAPVSGLESPRFAGIRTFARLPHVRELAGVDVAIVGAPFDT
FT                   GVTYRVGARFGPAAVREMSAMLRTYHPSLDVDVYEVLSVVDYGDLPVVPGYIEDSYQRI
FT                   EQGLLPLLEHDVVPLVIGGDHSITLAELRAVARRYGRVGFIQFDSHTDTWDEYWGKKYT
FT                   HGTPFRRAVEEGLIETTRAIQVGMRGSLYGPEDLDQSRELGFEVWTADDVRRTGLGAVI
FT                   EAIRRRVGQGPVFVSFDIDFLDPVYAPGTGTPEVGGFTTREAQELLRGLVGVDIVAADM
FT                   VEVLPAHDVSGVTALAAANLLFEILAVLAFNRRGMTR"
     atgcccaagg gctatgctcc ggtgagcggg ctcgagagcc cgcgttttgc tggaatccgc        60
     accttcgcgc gcttgcccca tgtgcgagag ctcgccgggg tggatgtcgc gatcgtcggt       120
     gcgcccttcg ataccggcgt gacctatcgt gtcggggcgc ggttcggacc agcggccgtg       180
     cgcgagatgt cggcgatgct gcgaacctac catccatcac tcgatgtcga tgtctacgag       240
     gtactgtcgg tcgtcgatta cggggacttg ccggtcgtgc ctggttacat cgaggacagc       300
     tatcagcgga tcgaacaggg actgttaccg ctcctcgagc acgatgtcgt cccgctggtt       360
     atcggtggtg accactcgat cactttagcg gagctgcgcg cggtcgcgcg ccgttacggc       420
     cgggtcggat tcattcagtt cgattcgcac accgatacat gggacgaata ttggggaaag       480
     aagtacacgc atgggacccc cttccggcga gcggtggagg aaggattgat cgagacgacg       540
     cgagcgattc aggtcgggat gcgtggctca ctctatggac cggaggatct cgaccagtcg       600
     cgggagctgg gcttcgaggt gtggacagcg gacgacgtgc ggcgcaccgg actcggcgcg       660
     gtgatcgaag cgatccggcg ccgagtcggc caggggccgg tcttcgtgag cttcgatatc       720
     gacttcctcg atccggtgta tgcgccaggt accgggacac cggaggtcgg ggggttcacg       780
     acgcgcgaag cgcaagaact cttgcgtgga ctggtcggtg tggacatcgt ggcagccgat       840
     atggtggagg tcctgcccgc ccatgacgtg agcggcgtca ctgccttagc tgcggccaac       900
     ctgttattcg agattctggc cgttctggcc ttcaaccggc gcgggatgac gcgctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page