(data stored in ACNUC30630 zone)

EMBL: CP001275.PE533

CP001275.PE533       Location/Qualifiers
FT   CDS_pept        complement(539789..539911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05024"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ9"
FT                   /protein_id="ACM05024.1"
FT                   /translation="MLGDRDGHCTDTSMGRNRCCVNRNPFPDGCYTAARRIGAR"
     atgctcggcg accgcgacgg tcactgtacg gacaccagta tggggcggaa ccgctgctgc        60
     gtcaaccgga acccgtttcc ggacggctgc tatactgctg cccggcgcat cggcgctcgc       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page