(data stored in ACNUC30630 zone)

EMBL: CP001275.PE542

CP001275.PE542       Location/Qualifiers
FT   CDS_pept        complement(547416..548336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0554"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01188"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05595"
FT                   /db_xref="GOA:B9KYK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK8"
FT                   /protein_id="ACM05595.1"
FT                   /translation="MTAAIEVHELVKQYGDVTAVAGINFTVARGEFFAFLGPNGAGKTT
FT                   TINILCTLARPTSGRARVASCDVVREPHRVRERIGIIFQDPSLDTQLTAWKNLALHARV
FT                   YGVPGTLWRQRAEQLLRLVELWDRRHQLVRTFSGGMKRRLELVRGLLHRPEILFLDEPT
FT                   LGLDPQTRRQIWSYLETLRRETGVTLFLTTHYLEEAEQCDRVAIIDHGRVIALDTPDRL
FT                   KARVGRDIIVLATADDARAASELRERFSLQPLVVDGTLRVEVERGDTFIPELVRQLSVP
FT                   IRSVSLRRPSLDDVFLALTGRQIRS"
     atgacagcag cgatcgaagt gcacgaacta gtcaagcagt acggggacgt cactgcggtt        60
     gccgggatca acttcacggt cgcacgcgga gaatttttcg cctttctcgg tcccaatgga       120
     gctggcaaga cgacgacgat caacatcctc tgcacgctgg ctcgccccac cagtggtcga       180
     gcgcgtgtcg cgagctgtga tgttgtccgc gaaccccacc gcgttcgtga acgcatcggc       240
     atcatcttcc aggatcccag tctggacacc cagctgaccg cgtggaagaa tctcgctttg       300
     catgcccgcg tctatggagt cccgggtact ctctggcggc aacgtgccga acagcttctc       360
     cgcctggtcg aactgtggga ccgtcgccac cagctcgtcc gcacgttctc tggcgggatg       420
     aaacggcggc tcgaactggt gcggggatta ctccatcgtc ccgaaatcct cttcctcgat       480
     gaaccgacgc tcggcttgga cccacagacg cgccgacaaa tttggtccta tttggaaacg       540
     ttgcgtcgcg agactggcgt caccttgttc ctgacgacgc actacttgga agaagcggag       600
     caatgtgacc gggtggcgat catcgatcac ggccgcgtca tcgcactcga tacgcccgac       660
     cggctgaagg cacgcgtcgg ccgagacatc atcgtcctgg cgacagccga cgatgcgcga       720
     gctgcctcgg agctgcgcga gcgttttagt ctccagcccc tggtcgtcga tgggacactc       780
     cgcgtggaag tggagcgagg cgacaccttt attcctgagt tggtgcgaca gctctcggta       840
     ccgatccgtt ctgtcagctt gcgacgcccg agcctggacg atgtgttcct cgctctgact       900
     ggcagacaga tccgctccta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page