(data stored in ACNUC30630 zone)

EMBL: CP001275.PE555

CP001275.PE555       Location/Qualifiers
FT   CDS_pept        564605..564730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04711"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM1"
FT                   /protein_id="ACM04711.1"
FT                   /translation="MPRHRPSSAEFGRAVGRSPEALGWQSACPLMSGARELLGGE"
     atgcctcggc acagaccgag cagcgccgag ttcggtcgcg cggtcggtcg gtcgccggaa        60
     gcactcggtt ggcagtcggc atgtccgctc atgtccggtg cgcgggagct cctcggtggt       120
     gagtag                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page