(data stored in ACNUC30630 zone)

EMBL: CP001275.PE564

CP001275.PE564       Location/Qualifiers
FT   CDS_pept        574761..575645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0577"
FT                   /product="carbon monoxide dehydrogenase medium chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="identified by match to protein family HMM PF00941;
FT                   match to protein family HMM PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06069"
FT                   /db_xref="GOA:B9KYN0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN0"
FT                   /protein_id="ACM06069.1"
FT                   /translation="MKPPRFRYHAPESLDEALAVLAETGDEAKPLAGGQSLIPMLNMRL
FT                   ARPSLLIDLNGLSELAGIELRDGVLVVRAMTRHRAVERSPLVAEHVPLLAEAIPWVGHL
FT                   PIRTRGTIGGSVAHADPAAEVPGVLVALDGAVRLASRRGERLVSADEFFLDLLTTAAEP
FT                   DELVTEVHFPLLGPHSGSAWLEIARRHGDYALVGAGAVLVLAEDGRTIQDARLSFIGVA
FT                   GRPVRARGAEAILRGQSIGEEAWKAAAAAVREELDPPSDLHASAQYRRSVAGVLAERAL
FT                   AIAAARAQGGVAA"
     atgaagccgc cgcgctttcg gtatcacgcg ccggaaagtc tcgatgaggc actggcggtt        60
     ctggccgaga caggtgacga ggccaaaccg ctcgccgggg ggcaaagcct gatcccgatg       120
     ttgaacatgc gtttggctcg ccccagtctg ctcatcgact tgaacggtct cagcgaactc       180
     gccggaatcg agctccgcga cggtgtgctg gtcgtccggg caatgaccag gcatcgagca       240
     gtcgagcgct cgccactggt cgctgaacac gttcccctcc tggccgaagc catcccatgg       300
     gtgggccatc tgccgatccg aactcggggg acgatcggcg gcagtgtcgc ccatgctgac       360
     ccggccgcgg aagttccggg agtactcgtc gcgctcgacg gagcggtacg gttggccagc       420
     cgacgtggcg agcggctggt ttccgccgac gagtttttcc tggatcttct caccacagcg       480
     gcagaaccag acgaattggt gaccgaagtg catttcccgc tgcttggacc acacagcggc       540
     agcgcgtggc tggagatcgc gcgacgacat ggcgactatg cattggtcgg ggctggagcg       600
     gtgctcgtgc tggcggagga tgggcgaacg atccaggatg cacggttgag cttcatcggg       660
     gtcgccggac gaccagtgcg agcacgcggg gcggaggcga tcctgcgcgg gcaatcgatc       720
     ggtgaggaag catggaaggc ggcagctgca gcggttcgcg aagaactcga cccgcccagt       780
     gacttacatg cctcagcaca gtatcggcga tcggtggctg gagtgctggc tgaacgggcg       840
     ctcgccatcg ctgcagcacg agcacaggga ggagtcgccg catga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page