(data stored in ACNUC30630 zone)

EMBL: CP001275.PE585

CP001275.PE585       Location/Qualifiers
FT   CDS_pept        594189..594566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05551"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ1"
FT                   /protein_id="ACM05551.1"
FT                   /translation="MGTVPTYRDVLMAVLSPGALVVLERLTPLICALYDLDLLLDYPVA
FT                   DQQQGSLRERLSERLERIVALLPSDVSPMANEVFTAVETLVTDVLGRELFLGEEIRRLE
FT                   LLDEAFRNDPLLFQLVRGRAN"
     atgggaacgg tgccaaccta tcgggacgtg ctcatggcag tactctctcc cggcgcgctc        60
     gtcgtcctgg agcgcctcac cccgctcatc tgcgccctct atgatttgga ccttctcttg       120
     gattaccccg tggctgatca gcagcagggt agcctacggg agcgcctgag cgaacggttg       180
     gagcggatcg tcgcgctgct cccgtccgat gtctcgccga tggcgaatga agtgttcacc       240
     gctgtggaaa ccctggtgac agatgtgctc ggacgcgaac ttttcctcgg tgaggaaatc       300
     cggcgtctgg aattgctgga tgaggcgttc cgcaacgatc ccttgttgtt ccagctcgtc       360
     cgtggaagag ccaattga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page