(data stored in ACNUC30630 zone)

EMBL: CP001275.PE598

CP001275.PE598       Location/Qualifiers
FT   CDS_pept        608032..609783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05144"
FT                   /db_xref="GOA:B9KYR4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR4"
FT                   /protein_id="ACM05144.1"
FT                   /translation="MKVARFIVLALLVFGVLANVVPVKHVQAAAPTVPEDLEMPRYFPE
FT                   TGFWVQGPFRRFWETQGALFVFGYPITGVFQQDGYWRQYFERAVFEYHPEKAGTVDEVQ
FT                   LVRVGAWRVSGREKEEPFRPVAWFPDTTDRRYFPETKHSLAYGFKNYWDRYGGWRVFGL
FT                   PLSEEFTEQNPPPPAGDGRSYTVQYFERARFEYHPENRGTPYEVLLGLLGWEYLQARGA
FT                   PAEARAKQDATLPPYDPIRKRQYGPHVGYGFNVAWRGDNDGDGFNQRTMELVKGAGFSW
FT                   IRVQAIWRDIEPRPGRYDTHALDRIIDAASRNGVKVVVSVVKAPAWADPNGGIPADPAP
FT                   FGKLMEFLAKRYAGKVHAWEIWNEQNLALETGGHVDVGRYVRLLKEGYQGVKRSDSKAI
FT                   VLFGGLTPTGVMDPSIAIDDVEYLRQAYAYNNGEIKRYFDHIATHPGGTLNPPDALWPE
FT                   RPGPGPGWIDHPSFYFRRAEQIRQVMVENGDGAKQVWLTEFGWSTANQAPGYEYGRYVS
FT                   EQQQAQYLVRAFQIARSQWPWAGVLLVWNLNFSTITQPSDEKYPWSVVYADWNPRPAYR
FT                   ALQEMPK"
     gtgaaggtcg cgcgattcat cgttctcgcg ttgctcgtgt ttggcgttct ggcgaacgtc        60
     gtaccagtga aacacgtgca ggcagcagcg ccgacggttc cagaagactt ggagatgcca       120
     cgctattttc ccgaaacagg tttctgggtc caggggccgt tccgccgctt ctgggaaacg       180
     caaggagctc tctttgtctt cgggtacccg ataacgggtg tctttcagca ggatgggtat       240
     tggcgacaat atttcgagcg ggccgtcttc gagtatcacc cggaaaaggc cggaacagtc       300
     gacgaagtcc agctcgtgcg ggtcggagcg tggcgggtga gtggtcgcga gaaggaggag       360
     ccgttccgac cggtggcctg gtttcccgat accacggatc ggcggtattt cccggagacg       420
     aagcattccc tggcatacgg cttcaagaac tactgggatc ggtatggggg atggcgggtg       480
     ttcggcttac cgctctccga ggagttcacg gagcaaaatc cgccacctcc ggcgggagat       540
     gggcgctcgt acacggtgca gtacttcgag cgcgcacgct tcgagtacca tcctgagaat       600
     cgcggaaccc catatgaagt gttgctcggt ctcttagggt gggaatacct ccaggcccgg       660
     ggagctcctg ccgaggcccg agccaagcag gatgcgactt tgccgcccta cgatcctatc       720
     cggaagcggc agtatggtcc tcatgtcggt tatgggttca atgtggcgtg gcgcggagac       780
     aacgacggtg acggtttcaa tcagcggacc atggagctcg tcaagggtgc aggcttctcc       840
     tggatacgtg tgcaggcgat ttggcgggat atcgagccgc gaccgggacg atacgatacg       900
     catgccctcg atcgcatcat cgatgcagca tcacgcaatg gcgtgaaagt cgtggtgagc       960
     gtcgtcaagg caccggcatg ggctgatccg aacggcggta taccggctga tccggcaccg      1020
     ttcgggaaac tgatggagtt cctcgccaag cgttacgctg gcaaggttca tgcctgggaa      1080
     atctggaatg aacagaattt ggcgctggaa accggcggac acgtcgatgt cggtcgctat      1140
     gtacgtctgc tgaaggaagg ctatcaggga gtgaaacgca gtgattcgaa ggcgatcgtc      1200
     ctcttcggtg gtctcacgcc gactggtgtg atggatccct cgatcgcgat cgacgacgtg      1260
     gagtacttgc ggcaggcgta tgcctacaac aatggcgaga tcaagcgcta tttcgaccac      1320
     atcgcgacac atcccggcgg cacgctcaac ccgcctgatg ccctgtggcc ggaacgaccg      1380
     ggaccgggac cgggctggat cgaccacccg agcttctact tccgtcgcgc agaacagatc      1440
     cggcaggtca tggtcgaaaa cggcgatggt gccaagcagg tgtggctaac cgagttcggc      1500
     tggtcgacgg caaaccaggc tcctggctac gagtacggca ggtacgtcag cgagcagcag      1560
     caggcgcagt atctcgtccg cgcattccag atcgcgcgct cgcagtggcc gtgggccggt      1620
     gtgcttctag tctggaacct gaacttcagt acgatcacgc aaccgagcga tgagaagtat      1680
     ccctggtccg tggtttatgc tgactggaac cctcggccgg catatcgggc gttgcaggag      1740
     atgccgaaat ga                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page