(data stored in ACNUC30630 zone)

EMBL: CP001275.PE599

CP001275.PE599       Location/Qualifiers
FT   CDS_pept        609780..610661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0619"
FT                   /product="probable dolichol-phosphate
FT                   mannosyltransferase-putative membrane bound sugar
FT                   transferase involved in LPS biosynthesis"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05587"
FT                   /db_xref="GOA:B9KYR5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR5"
FT                   /protein_id="ACM05587.1"
FT                   /translation="MNRLPSETRATMLPISGTLSLVLPAYNEAANLEAVVRRALEVLPA
FT                   LVEDFEVVIVDDGSRDGTSQIADRLAASDPRVRVVHHETNRGYGAALRSGFAAARGDLI
FT                   MFMDADQQFDPADFAHLAPFVPYADIVAGYRVKRRDPWIRLVYAAIFNAAMRLLFGITV
FT                   RDIDCAFKVLRGDLVRALHLTMNGALVNTELLVKAQRAGATIVEVGVRHYPRLSGEPSG
FT                   GSVRVIRRAVCEVAQLWWQLLWYQPPRGVGRGRPQPRSSQLVRAGVMVGLGATALYWLW
FT                   RRFAGGRPTQER"
     atgaacagac tcccgagcga gactcgagcg acgatgctgc cgatcagtgg cacgctctcg        60
     ctcgtcctac ctgcgtataa cgaagcagcg aatttggaag cagtcgtccg gcgagcgctg       120
     gaggttttgc cagctcttgt cgaggacttc gaggtggtca tcgtcgacga tggaagccgg       180
     gatggtacga gccagatcgc tgaccgactc gctgcttccg atccgcgtgt gcgggtggtt       240
     caccatgaga ccaaccgggg atacggtgct gccctgcgtt ccggcttcgc cgcggcacgc       300
     ggtgacctga tcatgttcat ggatgctgat caacagttcg atccagctga cttcgcgcat       360
     ctggcaccct ttgttcccta tgcggacatc gttgccgggt atcgggtcaa gcggcgtgat       420
     ccctggatcc gtctcgtcta tgccgcgatc ttcaatgcag cgatgcggct gctgttcggt       480
     atcaccgttc gggatatcga ttgcgccttt aaagtgctcc gaggtgatct cgtccgtgcg       540
     ttgcacttga cgatgaacgg ggcactggtc aatacggaac tcctggtcaa ggcacaacgc       600
     gcgggagcga ccatcgtcga ggtcggtgtc cgccactatc cgcgtttgag cggtgaacca       660
     tccggcggta gcgtgcgagt gatccggcgt gccgtctgcg aggtagcgca actgtggtgg       720
     cagctactct ggtatcaacc gccgcgtgga gtcggacgtg gacgcccgca gccgcgttcc       780
     agccagctcg tccgggcagg ggtaatggtg ggactcgggg caaccgcgtt gtactggctc       840
     tggcgacgat tcgccggtgg gcggccgact caggagcggt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page