(data stored in ACNUC30630 zone)

EMBL: CP001275.PE608

CP001275.PE608       Location/Qualifiers
FT   CDS_pept        619401..619514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05701"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS4"
FT                   /protein_id="ACM05701.1"
FT                   /translation="MLSERRTMRGSQQDTPSWPRVISFIRLRSGASTCWPS"
     gtgctgagcg aacgccgcac aatgagaggt tcccagcagg acacgccaag ctggccccgt        60
     gtcatcagct tcatccgatt gcgatccggt gcatccacct gctggccctc ctga             114
//

If you have problems or comments...

PBIL Back to PBIL home page