(data stored in ACNUC30630 zone)

EMBL: CP001275.PE619

CP001275.PE619       Location/Qualifiers
FT   CDS_pept        complement(627521..628963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0639"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05809"
FT                   /db_xref="GOA:B9KYT5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT5"
FT                   /protein_id="ACM05809.1"
FT                   /translation="MTIYQLTEPPQPLERLRGMQDTPPALHRRRQAVLHRIARVLERHG
FT                   YEFIETPILESTELFLRKSGPERIAQLYAFSFRNRDIALRPEHTASILRYYVESRQNDP
FT                   LPLRFAYAGPVFRYERPQAGRTRQFTEIGGELLGAPGPSGDAEVIHLAAEILEAVGIMP
FT                   RIVIGHVGIVLDYLAHLPLRQRARDWLLWSMERLRKGQTIDIESELPAFVDSTDIVQIT
FT                   QEVRTKLALTTEDLERLILALLREVGVPMTGASRQPEEIVRGVLAKLQRSADPDALRQA
FT                   LAFARELASLSGPPDDVLSALRRIVERYGLSPAPLQQIDEVLDQLAAYGLETDRIVLAP
FT                   GMARGLHYYTGILFEMYSQTDEGLQLCGGGRYDDLAQLLGARQPLPACGFAGGLERIAD
FT                   ASALQPKTEPRLLVTAADRSAITAATRFAEQLRASGAIVELDVRQRSLSSNRRYARRRG
FT                   VTEILIVDATGSVRRIDLSTEE"
     gtgaccattt accagctcac cgaaccaccg caacccttag aacgcttgcg cggcatgcaa        60
     gacacccccc ctgctcttca tcggcggcga caagcggttt tgcaccgtat cgctcgtgtg       120
     ctcgagcgtc acggatacga attcatcgaa acaccgatct tggaatccac cgaactcttc       180
     cttcgcaagt ccggtcctga acggatcgct cagctctacg ccttcagctt ccggaatcgc       240
     gatatcgccc tccgtcccga gcacacggca tcgatccttc gctactacgt ggagtcgaga       300
     cagaacgatc ccttaccgct gcgcttcgcg tatgcgggtc ctgttttccg ctatgagcga       360
     ccgcaagctg ggcgcacacg ccaattcacc gagatcgggg gtgaactgct gggtgctccg       420
     gggccgagcg gggacgctga ggtcatccac ctcgctgctg agattctcga agcagtcggg       480
     atcatgcccc gtatcgtcat cgggcacgtc ggtatcgtgc tggactatct cgctcatctg       540
     cccctccggc aacgtgcgcg cgattggctt ctttggagca tggagcgact gcgcaagggg       600
     caaacgatcg acatcgagag cgaactcccg gcattcgtcg attccaccga tatcgtgcag       660
     atcacccagg aagtgcggac aaaactcgcc ttgaccacgg aggacctgga acggttgatt       720
     ctcgcactgc tgcgagaagt cggcgtgccg atgaccggtg catcccgcca gcccgaggag       780
     atcgttcgcg gtgtcctggc aaagctccaa cgcagcgccg atcctgacgc gttgcggcaa       840
     gcactcgctt tcgcccgcga actggcgtcc ctctcgggtc cgccggacga cgtactctcc       900
     gcgctccgcc ggatcgtcga gcgctacgga ctcagtcccg caccactgca gcaaatcgac       960
     gaggtgctcg atcagctcgc cgcctatgga ctggagaccg atcggatcgt gctcgcgcca      1020
     ggaatggcac gcggactgca ctactacacg ggcatcctct tcgagatgta ttcccaaact      1080
     gacgagggac tgcaactgtg cggcggcggc cggtacgacg atctcgctca gctgctcggt      1140
     gcccgccagc cgctcccagc gtgcggcttc gccggtggcc tcgaacggat cgccgatgct      1200
     tcagccttgc agccgaagac cgagccacgc ctcctcgtca ccgcggccga tcgctccgcc      1260
     attacagccg ccacgcgttt cgccgagcag ctacgagcca gcggcgcgat cgtcgaactg      1320
     gacgtccgtc agcggtcact ttcttccaac cgtcgttacg cccgtcggcg cggcgtcact      1380
     gaaatcctga tcgtcgacgc gacgggttcc gttcgccgta tcgatctctc caccgaggaa      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page