(data stored in ACNUC30630 zone)

EMBL: CP001275.PE627

CP001275.PE627       Location/Qualifiers
FT   CDS_pept        complement(639235..640725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0647"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by match to protein family HMM PF00180"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04935"
FT                   /db_xref="GOA:B9KYU3"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU3"
FT                   /protein_id="ACM04935.1"
FT                   /translation="MEQSGGSGATMKYVVTPNGKKLVTLIPGDGIGPEIVESACRLIEA
FT                   VGAPIEWEVRRAGASVFREGIASGVPDDTIESIKRTRVVLKGPLETPVGYGEKSANVTL
FT                   RKLFEAFANVRPVRELPSVPTPYRGRNIDLVVVRENIEDLYAAIEYRETPGVTIAHKLI
FT                   SYKGSEKIIRFAFELARAEGRKKVTCATKSNILKLTEGWFQHIFEEIASEYPDIEANHL
FT                   IIDNCAHQLVKAPEQFEVIVTTNLNGDIISDLASGLVGGLGFAASGNYGHEVAIFEPVH
FT                   GTAPKYAGKNVINPTAMILTAVMMLRYIDEFETAETIEQALIVTLEEGKALTRDVVGDE
FT                   RAVSTTAFTDAIIANLGRRSATWKTRPYQPIRIPAQRPELDPVRPSRRRVVGVDLIVEG
FT                   TEPPQILGPNLERLIDDLPLRLHLISSRGLQVYPDVGTTIDYVDHWRCRFLSHDGEVST
FT                   ATVTALLERLSARYRWSRVQLLHEFDGEPGFTRAQGED"
     atggagcagt caggaggaag cggtgcaacg atgaagtacg tcgtgacccc gaatgggaaa        60
     aaactcgtga ccttgatacc tggcgacggc atcggaccgg agatcgtgga gagtgcttgc       120
     cgactcatcg aggcggttgg tgcaccgatc gagtgggaag tccgccgggc cggtgcgagc       180
     gtcttccgag aagggatcgc gagcggtgta cccgacgaca cgatcgagtc gatcaagcgc       240
     acccgggtgg tcctgaaggg accactggaa acaccggtcg gctatggcga gaagagtgcc       300
     aatgtgacgt tgcgcaagct cttcgaggca ttcgcgaatg tccgcccggt gcgcgaactc       360
     ccctcggttc ccacacccta ccgcggacgt aacatcgatc tcgtcgtcgt tcgcgagaat       420
     atcgaagatc tctacgctgc tatcgaatat cgcgaaactc ctggagtgac catcgcccat       480
     aagctgatat cctataaagg gagcgaaaag atcatccgct ttgccttcga actcgcccgc       540
     gcagaaggca ggaagaaggt tacctgcgcg accaagtcca atattttgaa actgaccgaa       600
     ggatggtttc agcacatttt cgaggaaatc gcttccgagt acccggacat cgaagccaac       660
     cacctcatca tcgataactg tgcacaccaa ctcgtcaaag ctcctgagca gttcgaggtc       720
     atcgtcacga ccaatctgaa tggtgatatc atctccgatc tcgcctcggg tctggtcggc       780
     gggctcggct tcgccgcctc aggaaattac ggccacgagg tagccatttt cgaacctgtg       840
     cacggcacag caccgaaata tgctgggaag aacgtcatca atcctaccgc catgatcctc       900
     actgcggtga tgatgttgcg ctacatcgac gagttcgaga cagcggagac gatcgagcaa       960
     gccctcatcg tcacgctcga agaagggaaa gcgctcaccc gcgatgtcgt cggcgacgag      1020
     cgagccgttt cgacgacggc cttcaccgat gcgatcatcg ccaatctcgg ccgtcgttcc      1080
     gcaacgtgga agacacgtcc ttaccagccg attcgtattc ctgcacagcg cccggaactc      1140
     gatccagttc gtcccagtcg acgccgtgtg gtgggcgtcg acctcatcgt cgagggaacc      1200
     gaaccacccc agatcttggg gcctaatctc gagcgcctga tcgacgatct cccgctacgg      1260
     cttcacctca tttcgagtcg tggccttcag gtctatcctg acgtcggcac caccatcgat      1320
     tacgtcgatc actggcgctg ccgattcctg agccacgacg gggaggtctc cacagcaacg      1380
     gtcactgccc tgctcgaacg actgagcgct cgctatcgtt ggagccgggt ccagctgctg      1440
     cacgagttcg atggggagcc tggtttcacc cgtgcccagg gcgaggattg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page