(data stored in ACNUC30630 zone)

EMBL: CP001275.PE7

CP001275.PE7         Location/Qualifiers
FT   CDS_pept        complement(7673..7795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05143"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A7"
FT                   /protein_id="ACM05143.1"
FT                   /translation="MIRAFSTVLGAALKRARTMTRRCVQLSSSDELSGDCAGRG"
     gtgatccgcg cgttcagtac cgtgctcggt gctgcgctga aaagagcccg aaccatgacg        60
     cgtcgttgcg tgcagctctc atcgagcgac gagctttccg gcgactgtgc tggccggggc       120
     tag                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page