(data stored in ACNUC30630 zone)

EMBL: CP001275.PE72

CP001275.PE72        Location/Qualifiers
FT   CDS_pept        complement(82533..84128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0074"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05012"
FT                   /db_xref="GOA:B9L292"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B9L292"
FT                   /protein_id="ACM05012.1"
FT                   /translation="MQAYLVTNGTILTMDPSQPQVEAFGVIGEWIVSAGSLAEVEAALP
FT                   RGAGRLDLAGATCLPGFNEAHNHMLNFGFVLGQVNCRYPAVRSIEEIVARFAERAEGTP
FT                   PGSWIRGRGYDDNKLTEHRHPTRWDLDRASTAHPLVLVHSSGHMLVANSLALQLAGVSR
FT                   ETPDPPGGHIVRDEHGDPTGLLQENAMELIERVIPAPTLEDMVEALRRCNDAYVAAGIT
FT                   SSQDAGLDDPQQVEAFQRAVQRGLLRLRTSIMLRHQLLPHLLGLGIKQGFGNHHLRIGP
FT                   VKLFADGSLIGRTAAVSRPFLADPRSDNCGITIWSQEELDELVWQAHAAGFQVATHAIG
FT                   DRAIEMVLDAYERALARLPRPDHRHRIEHGGVLRPDLIERIARLGVLVVSQPIFIAEYG
FT                   DGFIRHLGLERIQLTYPFRSLLDAGIRLVFSTDCPVSAYQPLRCIQAAVQERTASGRSY
FT                   ALEEAITVEEALPLYTVNGAYASFEEHCKGMLRPGMLADFVVLERDPRRVDPEELAEIR
FT                   VLRTVIGGETVYEA"
     atgcaggcgt atctggtcac caacggcacc attctgacca tggacccgag ccagccgcag        60
     gtggaagcgt tcggcgtcat cggggagtgg atcgtctcgg ccggttcgct ggccgaggtg       120
     gaagcagcct tgccgcgcgg ggcgggtcgg ctggatctgg ctggcgcgac gtgcctaccc       180
     ggcttcaacg aagcccacaa ccatatgctc aatttcggtt tcgtgctggg gcaggtcaac       240
     tgccgctatc ctgcggtccg ttcgatcgag gagatcgttg cccgcttcgc cgagcgtgcc       300
     gaaggaacac cgcccggcag ctggatccgc gggcgcggtt acgacgacaa caagttgacc       360
     gagcaccgcc acccgacccg ctgggatctc gatcgcgcca gcacggcgca cccgctcgtc       420
     ctcgtgcaca gctccggaca catgctcgtc gccaactcgc tggcactgca actggctggt       480
     gtgagccgcg agacgcccga cccgcctggc gggcacatcg tgcgtgatga gcacggtgac       540
     ccgactgggc tcctccagga gaacgcgatg gaactcatcg agcgagtcat tccggcaccg       600
     acgctcgagg atatggtgga agcgctccga cgctgcaacg atgcgtatgt cgcggccggc       660
     atcacttcga gccaggatgc cgggctcgac gatccccagc aggtcgaagc gttccagcgg       720
     gcagtccagc gagggttact tcggctccgc acctccatca tgctccggca ccaactccta       780
     ccccacctcc tcggcttggg tatcaagcag ggattcggca accatcacct ccgcatcggc       840
     ccggtcaagc tcttcgccga tgggagcctg atcgggcgta ctgcggcggt gagtcgaccc       900
     ttcctcgccg atcctcgctc agacaactgc gggatcacca tctggtctca ggaggagttg       960
     gacgagttgg tctggcaggc acacgccgcc ggctttcaag tcgccacgca cgcgatcggc      1020
     gaccgggcga tcgagatggt gctcgacgcc tacgagcgtg ccctcgcgcg gctgcctcgc      1080
     ccggaccacc gtcaccgcat cgaacacggc ggcgtcttgc gtcccgacct catcgagcgg      1140
     atcgcccgtc tcggcgttct cgtcgtcagc caaccgatct tcatcgccga atatggcgat      1200
     ggattcatcc gccacctcgg cctcgaacgg atccagctca cctatccgtt ccgtagcctt      1260
     ctggatgcag gcatccggct cgtcttctcg accgattgcc cggtttcggc ctaccagccc      1320
     ttgcgctgca ttcaggctgc ggtgcaggag cgaaccgcca gcgggcgctc gtacgcgctg      1380
     gaagaagcga tcaccgtcga ggaagcactg ccgctctata cggtcaacgg cgcctacgcg      1440
     agcttcgagg agcactgcaa ggggatgctc cggcccggca tgttggccga cttcgtcgtg      1500
     ctggagcgcg acccgcgccg cgtcgatccc gaggaactgg cggagatcag ggtgctgcgt      1560
     accgtcatcg gcggcgagac ggtctacgag gcgtaa                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page