(data stored in ACNUC30630 zone)

EMBL: CP001275.PE8

CP001275.PE8         Location/Qualifiers
FT   CDS_pept        complement(8491..11175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06006"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A8"
FT                   /protein_id="ACM06006.1"
FT                   /translation="MHETGLRLATLLESVFPPRIARWIAAPAQRTPLDAALPAIWWRSQ
FT                   VCSLVLRLSPPHRRGDRAGLLYALHLAGASTARLAVVTGAEESRISDALLAVRAQLSDH
FT                   WSDPCPEGREGVASWRDRLADRDAWLALLLHTRTCSACRTALATSREVDEQVLERASTV
FT                   PVPPAPRQRRHPSIVVLVALALLLVFASWRLPGNRALGPPGETAAPSASGPYVWFGSAG
FT                   PYALAFDLGQRRWLAVTSRLPADAGGFRLLGPDGQLIAAWTPDPPREPRWLDILRWDGT
FT                   RLARYRWDRQTNRRPLAWLDATTLLIRETPVRHAYEREAEYLERLQRDARVLALDVLQG
FT                   TETTLLRELVTDAIPSPDGRSVAVVRAMEPFGAGATSRQIAIVERSGTRVLAVADGYVG
FT                   AGLDHPLWLPDSSALLFARRPPGTPPQLPTPTELVRFTLEGKTAIVVPSSPGTVLRPLA
FT                   LDEQRLFYLALPAGHAEPGELWELDLATSVRRRLGQLDRLNGFLTILPQPDSPLLVAVR
FT                   TLPASPPLRPESEVTELYRIGEDAPELIAAVPGRWGFDAWGQPLAVVTTTAPSAAASPL
FT                   VPPTGPLGAGPLALAPGRNWLLAPVPDGRVAIWDATSGIQLTEPWPFRKPHWHPAGLAF
FT                   VALGELGELQLVARSPDGFWQAVPLALDAPRGDTLDLTVGPDGRLALLTRTDGGELALW
FT                   AGFPPQALELARWRGPELVGTPCMAWLRTGTLLVAAPLVGGQLLLTSITIEERGRVAVR
FT                   TLARLRTDRGPAVETCTLALEPSGGALALRAGSRERERIVLLWLAEPDSPLILAEGRAS
FT                   RGLAWSPDGALLAGPLDGALVVHGRNGREVLNQRAAGLADLVWVDTRELWVLERSEAGS
FT                   AIHRVAIIDLSEAPTRAARPSAG"
     atgcacgaga caggactcag gctcgccacc ctcctcgaga gcgttttccc gccccgcatc        60
     gcgcggtgga tcgctgcacc tgcccagcgg acgccactgg acgcagcgct gccggcgatc       120
     tggtggcgga gccaggtctg ttcgctcgtc ctgcgcctct cgcccccgca ccggcgcggt       180
     gatcgagcgg ggctcctcta cgcgcttcac ctggccggcg catccaccgc tcgactcgcc       240
     gtagtgaccg gcgcggagga atcgcgcatc agcgacgcac tgctcgcggt gcgcgcccag       300
     ctgagtgacc actggagcga cccctgtccg gaggggcggg agggggtcgc atcctggcgc       360
     gatcgcctgg cagaccgcga tgcctggctc gcgctcctgc tccatacccg cacctgctcc       420
     gcttgccgga cggcgctggc gacgagccgc gaggtcgatg agcaggtact cgagcgtgcc       480
     agcaccgtac cagttccccc tgctccccgt cagcgccggc atccgagcat cgtcgtgctg       540
     gtcgcgctcg cgctgcttct cgtcttcgcc agctggaggc tcccgggaaa ccgcgcgctc       600
     gggccgcccg gcgagaccgc tgcaccgtcg gcgagcggac cgtacgtttg gttcggctcg       660
     gccggtccgt acgcgctcgc cttcgatctc ggccagcgtc gctggctcgc cgtgaccagt       720
     cgcctgccgg ccgatgccgg agggttccga ctgctcggtc ccgatggcca gctgatcgcc       780
     gcttggacac ccgatccacc gcgcgagccg cgctggttgg atatcctgcg ctgggacggc       840
     acgcgtctcg ctcgctaccg ctgggaccgc cagacgaacc gccggccact cgcctggctc       900
     gatgcgacga cgctcctgat ccgggaaacg ccggtccggc atgcctacga acgcgaggca       960
     gagtacctgg agcgcttgca gcgcgacgcg cgggtgctgg cactcgatgt cctgcagggc      1020
     acggagacga cgcttctccg cgaactcgtg accgacgcga tcccttcacc cgacggccga      1080
     tcggtggccg tcgtgcgagc gatggagccg ttcggcgccg gcgcgaccag ccgacagatt      1140
     gcgatcgtcg aacggtccgg gacgcgcgtc ctcgcggtcg ctgatggata cgtcggggca      1200
     ggactcgacc acccgctgtg gctgccggat agctcagcgc tcctcttcgc ccgccgcccg      1260
     ccaggcactc caccacagct gccgaccccc acggagctgg tgcgcttcac cctggagggc      1320
     aaaaccgcga tcgtcgtgcc gagctcgccg ggaaccgtgc ttcggcccct tgcgctggac      1380
     gagcagcgac tgttctactt ggcgctgccc gccgggcacg ccgaaccagg ggagctgtgg      1440
     gaactggacc tggcgaccag cgtccgacgg cggctcgggc agctggaccg gctgaacggg      1500
     tttctcacta tccttccgca gccggacagt ccgctcctcg tcgccgtgcg cactctgccg      1560
     gcatcgccgc cgctgcgccc ggaaagcgag gtgaccgaac tctaccggat cggagaagat      1620
     gctccggaac tgatcgctgc cgtgccgggg cgctggggat tcgacgcctg ggggcaaccc      1680
     ctcgccgtgg taacgacgac tgcgccatca gcggccgcat cgccactcgt gccgccgact      1740
     gggccgctgg gagccggtcc gctcgccctc gcccctggcc ggaactggct gctggcgcct      1800
     gtccccgacg ggcgcgttgc gatctgggac gcgacgagcg gtatccagtt gaccgagccg      1860
     tggccgttcc ggaaaccaca ctggcatccg gctggactcg ccttcgtcgc cctgggcgag      1920
     ctgggggaac tccagctcgt cgctcgctcg ccggacggat tctggcaagc ggtaccgctc      1980
     gcgctggatg ccccgcgcgg cgataccctg gacctcaccg tcgggccgga cgggcggctg      2040
     gcgcttttga cacgaaccga tggtggcgag cttgctctct gggcaggctt cccgccgcag      2100
     gcgctcgagc tggctcgctg gcgtggacca gaactggtcg ggacgccgtg catggcgtgg      2160
     ctgcgtaccg gaaccttgct ggtagccgct ccgttggtcg gcggacaact gctgctgacg      2220
     tccatcacga tcgaggaaag gggaagggtc gcggtccgca cgctggcacg cctgcgcact      2280
     gaccggggac cagccgtcga gacgtgcacc ctggcgctcg aaccgtccgg aggagcactc      2340
     gccctccgag cggggtccag ggaacgcgag cgcatcgttc ttctctggct cgccgagccg      2400
     gattcaccgc tgatcctcgc cgagggaaga gcgagcaggg ggctcgcctg gtcaccggac      2460
     ggcgccctct tggctggtcc gctcgacgga gcgctcgtcg ttcatggccg gaacggccga      2520
     gaggtgctga accagcgcgc ggcggggctc gctgatctcg tgtgggtgga tacgcgagaa      2580
     ctctgggttt tggagcgatc cgaagcaggt tccgcgattc accgcgtcgc gatcatcgat      2640
     ctttcggagg cgccgacgcg agccgcgcgg ccatcggcag gctga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page