(data stored in ACNUC30630 zone)

EMBL: CP001275.PE94

CP001275.PE94        Location/Qualifiers
FT   CDS_pept        105421..106008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0096"
FT                   /product="N6-adenine-specific methylase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06368"
FT                   /db_xref="GOA:B9L2B4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B4"
FT                   /protein_id="ACM06368.1"
FT                   /translation="MRVIGGSARGRRLKAPRGLRTRPMADKIREALFSMLDSLGIRPQR
FT                   VLDLYAGSGAIGIETLSRGARWVDFVDRSAAACAVIRDNLTATGFADRGAVHCTTVQAF
FT                   LRRPPREPYDFVIMDPPYADPTIHETMLAVARSPHVRDGTILVVGHSPRVPMPERLDGL
FT                   EQLRDRCHGDSCVAIYVIRRGERAEAEDEGDP"
     atgcgggtga tcggcggaag tgcccggggg cgtcggctca aagccccgcg cgggttgcgc        60
     acgcgcccga tggcggacaa gatccgcgag gcgctgttca gcatgctgga ctcgctcggc       120
     atccgcccgc agcgggtgct cgatctctat gccgggagtg gagcgatcgg catcgaaacg       180
     ctctcgcgcg gtgcgcgctg ggtcgacttc gtggaccgga gcgcggcggc ctgcgcggtg       240
     atccgcgaca atctgactgc gactggcttc gctgatcgag gggcagtgca ttgcacgact       300
     gttcaagcct tcctgcgccg gccgccccgc gagccctacg atttcgtgat catggatcct       360
     ccgtatgccg atccgacgat ccacgagacg atgctcgctg tcgcgcggtc ccctcatgtt       420
     cgggatggga ccatcctcgt ggtcggccac tcgccgcgcg taccgatgcc cgaacggctc       480
     gatggtctgg agcagctccg ggatcgctgt catggcgaca gctgcgtggc gatttacgtc       540
     attcggcgag gtgagcgagc tgaagcagaa gacgaggggg atccgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page