(data stored in ACNUC30630 zone)

EMBL: CP001275.PHES

CP001275.PHES        Location/Qualifiers
FT   CDS_pept        complement(631446..632525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="trd_0641"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04686"
FT                   /db_xref="GOA:B9KYT7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT7"
FT                   /protein_id="ACM04686.1"
FT                   /translation="MSATTPEQEVSVNTDRIEELRQRAKRELLAITTQAALAEWYARYL
FT                   GRRGELTQLLRALGTLPPEQRPIIGRLANELRDELQAAYEEREREVREIELAARIAAEA
FT                   IDVTLPGRRPRIGTLHPVTQMIREVTDIFAHLGFQVVEGPEVEYGSYAFDALNIPPEHP
FT                   ARDVWDTIFIESDQKEIVLRPHTSPMQIRVMERRKPPVRVVVPGRCYRYEAVDATHEWH
FT                   FHQIEGLAVDEQITMADLKGTLAEFARQLFGKERRVRFRCDFFPFVEPGVDFAIDCMFC
FT                   RGEGCRVCGQSGWIEILGAGMVHPQVLRNVGYDPDRYTGWAFGMGVERLVMLRYGVPDI
FT                   RYFYQGDLRFLAQFDRIPV"
     atgagcgcga cgactccgga gcaggaggta tccgtgaaca ccgatcggat cgaggaactg        60
     cgacagcgtg ccaaacgaga actcctggcg atcacgacac aggctgcgct cgccgaatgg       120
     tacgctcgat acctcggccg acgcggagag ctgacgcaac ttttgcgagc cttgggtacg       180
     ctgccaccag aacaacggcc gatcatcggg cgactcgcca atgaacttcg ggatgaactc       240
     caagccgcct acgaggaacg cgagcgcgag gtacgcgaga tcgagctcgc cgcccgcatc       300
     gcggcggaag cgatcgatgt gacgcttccc ggccgacgcc cgcgcatcgg gacactccac       360
     cctgttacgc aaatgattcg cgaggtaacc gacatcttcg cccatctcgg cttccaggtg       420
     gtcgagggtc ctgaagtgga atatggctct tacgcgttcg atgcgctcaa tattccaccg       480
     gagcacccgg ctcgcgacgt gtgggacacg atcttcatcg agtccgacca aaaggagatc       540
     gttctgcgtc cgcatacttc gccgatgcag atccgcgtga tggagcgccg aaagccaccg       600
     gttcgcgtcg tggtgcccgg tcgttgttac cggtacgaag cggtcgacgc gacgcatgaa       660
     tggcatttcc accagatcga ggggctcgcc gtcgatgaac agatcacgat ggctgatctg       720
     aaagggacgt tggccgagtt cgcacgccag cttttcggta aggaacgacg cgtccgcttt       780
     cgctgcgatt ttttcccctt cgtcgaaccg ggggtcgact tcgccatcga ctgcatgttt       840
     tgccgtggcg agggctgccg agtgtgcggc caaagcgggt ggatcgagat cctgggtgca       900
     gggatggttc acccgcaggt actccgcaac gtcggatacg atcctgaccg gtataccggt       960
     tgggcattcg gcatgggtgt cgagagactg gtgatgcttc gctatggtgt tcctgatatc      1020
     cggtacttct accaaggcga tctccgcttt cttgctcagt tcgaccgcat accggtctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page