(data stored in ACNUC30630 zone)

EMBL: CP001275.PHET

CP001275.PHET        Location/Qualifiers
FT   CDS_pept        complement(628960..631413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="trd_0640"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05510"
FT                   /db_xref="GOA:B9KYT6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT6"
FT                   /protein_id="ACM05510.1"
FT                   /translation="MKVPMRWLQELVATDRSAEEIAERLTLAGLEVESIERIGAHWDKI
FT                   YVGVVEKIEPHPNADRLVLATVDAGAHRLTVVTGAPNIAVGQKVALALAGATLYDGHSA
FT                   EPRLITLKPATIRGVRSEGMVCSEKELGLSEEHEGILVLDPDAPVGIPLRDYLGDEILE
FT                   LSITPNRVDAYSIVGIAREVAALTNSPLRLPELAPIQVSVDPTLATVEASDLCHRFVGI
FT                   ALEGIRVAPSPWWLRRRLQLVGLRPINNVVDVTNYVMIEWGQPQHAFDRSRLRGGRLIV
FT                   RRARPGEEIETLDHVRRPLNPDMLVIADAERPVGIAGVMGGLESEISDETTDVLLETAN
FT                   FDMLSIRRTARTLRLRTEASARFERGLDPNLCWPAAQRAVQLLSVLVPTCRVVAMVDHY
FT                   PVPRRPWQIRFPRSEIPRLLGVDYPDERVISVFESLGLSVERGWDNGRSVWLVTVPTYR
FT                   SDITIPADLVEEAARVIGYDTIPERLPVGQTVPVEIDPELRLVRQIQNGLVAAGLHEVI
FT                   TYPMVDDQALMALTPSGDRLPERIGFFIRPTQEFVRARNPIRPEWSIMRPSMLPTLLRN
FT                   AAEQLKFNEAVAIFETGKVYLPRQRDELPDERRVVGCLLAGLATPRDLYQDERPVDYFD
FT                   LKGILETILPRIGVADVAFCALTHPTLQPGRSAEIRARGRPIGVLGEVLVTVTERFGIP
FT                   PQTRVVVAEIDIPAILEIGLAPISVRPVSRYQPVDQDFAIVVDESVPAADVAAAIRAAA
FT                   GPLATEIRLFDVYRGPAIPPGKKSLAFRVIFSAPDRPLSEEELQRLRERIEQQVRRRVK
FT                   GEFRR"
     atgaaggttc cgatgcgctg gctccaggaa ttggtcgcga ccgaccgctc tgcagaggaa        60
     atcgccgaac ggcttacgct cgccggactc gaggtcgagt cgatcgagcg gatcggtgca       120
     cattgggaca agatctacgt cggtgtggtc gagaagatcg aaccccatcc gaatgctgat       180
     cgactcgtct tggccacggt cgatgcggga gcccatcgtt tgaccgtggt gacgggagcg       240
     ccgaatatcg ccgtcggaca gaaggtcgcg ctggctctcg ccggcgcaac gctctacgat       300
     ggccacagcg cagagccccg gctaatcacg ctcaaacctg ccaccatccg cggtgtccgc       360
     tcggaaggaa tggtgtgttc cgagaaggaa ctcggccttt ccgaggagca cgagggcatc       420
     ctggtgctgg atccggacgc tccagtcggt atcccgctcc gtgactatct cggtgacgag       480
     attctggaac tgtccatcac accgaatcgt gtcgacgcct actcgatagt cgggatcgca       540
     cgcgaggtcg ctgcactgac gaattcaccg ctccggcttc ccgaattggc accgatccag       600
     gtctccgtcg acccgaccct cgcgacagtc gaggcgagcg acctctgcca tcgcttcgtc       660
     ggtatcgcac tcgagggaat ccgcgtcgcc ccctcgccgt ggtggctgcg ccgccgactc       720
     caactggtcg gccttcgccc gatcaacaac gtggtggatg tcacgaacta cgtcatgatc       780
     gagtggggac agccgcaaca tgccttcgac cggtcccgtc tgcgtggcgg ccgcttgatc       840
     gtgcggcgag cccggcccgg tgaggaaatc gagacgctcg atcacgtccg tcgtccactc       900
     aaccccgaca tgctcgtcat tgccgacgcc gagcgtccag tcgggatcgc tggcgtgatg       960
     ggcgggctcg agagcgagat cagcgacgag acgaccgatg tcctcttgga aaccgcgaat      1020
     ttcgacatgc tcagcattcg acgcaccgcg cgtacgctcc ggttgcggac cgaggcctcc      1080
     gctcgcttcg agcgcgggct cgatcccaat ctttgctggc ccgccgccca gcgcgcggtg      1140
     caattgctca gcgtactggt tccgacctgc cgcgtcgtcg cgatggtcga ccattatccg      1200
     gtcccgcgcc gaccgtggca gatccgattc ccgcgcagcg agatccctcg cctcctcgga      1260
     gtggactatc cggacgaacg cgtgatcagc gtcttcgaaa gcttggggct ttcggtcgag      1320
     cgtggatggg acaatgggcg ctcagtttgg ctggtcacag tgccaacgta tcgcagcgac      1380
     attacgattc ccgctgacct cgtcgaggag gcggcacgcg tcatcggtta cgacaccatt      1440
     cccgaacgtc tgccggtggg acaaaccgtc cccgtcgaaa tcgatccgga attgcgcctc      1500
     gtgcgccaaa tccaaaacgg gctcgtcgct gccggcctcc acgaagtgat cacctacccg      1560
     atggtcgatg atcaagcgct catggcactc acaccgtcgg gcgaccggct gccggaacgc      1620
     atcggcttct tcatacggcc aactcaagag ttcgtgcgag cccgcaatcc aatccggccg      1680
     gaatggtcga tcatgcgacc gtccatgtta ccgacgctct tgcgcaacgc tgccgaacag      1740
     ctcaaattca atgaagcggt cgccatcttc gagacaggaa aagtctacct accgcgacaa      1800
     cgagacgaat tgccggacga gcgacgggta gtcggctgtc tgctcgcggg gctcgcgaca      1860
     ccacgtgatc tctaccaaga cgagcgtccg gtcgattact tcgatctcaa gggcattctc      1920
     gaaacgatcc tgccgaggat cggcgtcgca gacgtggcat tctgcgcgct cacgcatccg      1980
     acacttcaac ccggccggag cgccgagatc cgcgcacgag gacgtccgat cggcgtgctg      2040
     ggcgaagtac tggtgaccgt caccgaacgg ttcgggatcc cgccacagac gcgtgtcgtc      2100
     gtagccgaaa tcgatatccc ggcgatcctg gagatcggcc tggcgcccat cagcgtccga      2160
     ccggtttcgc gctatcagcc tgtcgaccag gacttcgcga tcgtcgtcga cgagtcggtc      2220
     ccggccgccg atgtcgcggc agccattcgg gctgcagcag ggccgttggc cacagagatc      2280
     aggctgttcg acgtctatcg tggtccagct atacctcccg ggaagaagag cctcgcgttc      2340
     cgagtcattt tctcggctcc cgaccgccca ttgagcgagg aggaactgca gcgcctgcgc      2400
     gaacggatcg agcaacaggt ccgtcgacgg gtcaagggag agttccgccg gtga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page