(data stored in ACNUC30630 zone)

EMBL: CP001275.PURE

CP001275.PURE        Location/Qualifiers
FT   CDS_pept        complement(638704..639219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="trd_0646"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05547"
FT                   /db_xref="GOA:B9KYU2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU2"
FT                   /protein_id="ACM05547.1"
FT                   /translation="MQVTNASSRPLVGIIMGSRSDWETMSHAASTLDHLNIPYEVRVVS
FT                   AHRTPDLMFEYAATAEARGIEVIIAGAGGAAHLPGMTAAKTVVPVLGVPVQTHTLHGLD
FT                   SLLSIVQMPAGVPVGTLAIGRAGAVNAALLAAAILGTKYPEIRERLRRFRDEQTRAVLE
FT                   NPDPRQAP"
     gtgcaggtaa caaacgcttc ctcgcgcccg ctcgtcggca tcatcatggg ctcacgatcc        60
     gactgggaga cgatgagtca cgctgccagc acgctcgatc acctgaatat tccgtacgag       120
     gttcgtgtcg tgtcagcgca ccggactccg gacctcatgt tcgagtatgc ggcgacagcc       180
     gaagcacgcg ggatcgaggt catcatcgcc ggagctgggg gcgccgccca tctgcccggg       240
     atgaccgccg ccaagactgt cgtaccggtt ctcggcgtgc cggtgcagac ccacacgctg       300
     cacggactcg attcgctgct ttcgattgtc cagatgcctg ccggagtacc ggtcggcaca       360
     ctcgccatcg gtcgcgccgg tgcagtcaat gctgcgctcc tggcagcagc tattctcggg       420
     acgaagtacc ccgagatccg cgagcgtctt cgccgtttcc gagacgaaca aacgcgcgca       480
     gttctggaga accctgaccc gcgacaggca ccgtga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page