(data stored in ACNUC30630 zone)

EMBL: CP001275.RIBH

CP001275.RIBH        Location/Qualifiers
FT   CDS_pept        501919..502434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="trd_0505"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06044"
FT                   /db_xref="GOA:B9KYF9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF9"
FT                   /protein_id="ACM06044.1"
FT                   /translation="MMSLNGQAIRVVEGKLTGRGRRFAIVVSRFNEFISRQLLHGAIDA
FT                   LVRHDVEPQAIEVVWVPGSFEIPLVAKRLAESRRYHAVICLGAVIRGATPHFDYVAAEV
FT                   SKGIAHVALQTNVPVVFGVLTTDTIEQAVERAGTKMGNKGAEAALVAIEMANVLAELDR
FT                   LAVTPLEA"
     atgatgtcgc tgaatggtca ggcgatccgc gtcgtcgaag ggaagttgac cggacgaggc        60
     cgacgcttcg ccatcgtcgt cagccggttc aacgagttca tttcgcggca attgctccac       120
     ggtgcgatcg atgcgctggt acgccatgac gtcgagccac aggcgatcga ggtcgtctgg       180
     gttcctgggt cgttcgagat tccgctcgtc gccaagcgtc tggctgaatc gcgccggtac       240
     cacgctgtca tctgtttggg cgcagtgatc cggggagcca cgccgcattt cgactatgtg       300
     gcggctgagg tctccaaggg aatcgctcat gtggcgttgc agaccaatgt cccggttgtc       360
     ttcggggtgc tgacgaccga caccatcgag caggcggtcg agcgtgcggg aaccaagatg       420
     gggaacaagg gagcagaagc agcactcgtt gcgatcgaga tggccaacgt cttggccgaa       480
     ttggatcgtc tcgctgtgac tccgctcgaa gcgtga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page