(data stored in ACNUC30630 zone)

EMBL: CP001275.RPMB

CP001275.RPMB        Location/Qualifiers
FT   CDS_pept        100807..100998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="trd_0089"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05298"
FT                   /db_xref="GOA:B9L2A7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L2A7"
FT                   /protein_id="ACM05298.1"
FT                   /translation="MAMCELCGKKPMFGHNVSHSNRKTNRKFKPNVQRVTVILNGVPKR
FT                   MRICTRCLRTLYKEAREA"
     atggcgatgt gcgaactctg tggcaagaag ccgatgttcg gccataacgt cagccactcc        60
     aaccggaaga cgaaccggaa gttcaagccg aatgtccagc gggtgacggt catcctgaac       120
     ggtgtcccga agcgtatgcg catctgcaca cgctgcctcc gaacactcta caaagaggct       180
     cgcgaggcgt ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page