(data stored in ACNUC30630 zone)

EMBL: CP001275.SUFB

CP001275.SUFB        Location/Qualifiers
FT   CDS_pept        complement(382121..383536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="trd_0380"
FT                   /product="FeS assembly protein SufB"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01980"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04549"
FT                   /db_xref="GOA:B9KY37"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY37"
FT                   /protein_id="ACM04549.1"
FT                   /translation="MTTPEVELKRLGSEYAEKYGFRDPEQYVFKARKGLDREVVEQISW
FT                   IKNEPEWMREFRLKALEYFLRRPMPTWGADLSELNFDEIVYYIKPTERQGTSWEELPEH
FT                   IRRTFDRLGIPEAERRFLAGVGAQYESEVVYHSLREELKRLGVIFCDMDTAVREYPDLV
FT                   KQYFGTIVPPNDNKFAALNSAVWSGGSFVYVPEGVRVDVPLQAYFRINAENVGQFERTL
FT                   IIVEPGAYVHYVEGCTAPIYSAASLHSAVVEIIVKEGARCRYTTIQNWSKNVYNLVTKR
FT                   AAAYRDATMEWVDGNLGSKVTMKYPAVWLMEPGARGEVLSVAFAGDGQHQDAGGKMVHV
FT                   APYTSSQIISKSISKGTGRASYRGLVKVHRGAHHVRANVVCDALLLDEQSRTDTYPYME
FT                   IEEEQVSIGHEATVSKVAEEQLFYLQSRGLTEAEAMSMIVNGFIEPITKELPLEYAVEL
FT                   NRLIALEMEGSVG"
     atgacgacac cagaagtcga actcaagcga ttgggaagcg agtacgccga aaagtacggg        60
     ttccgcgacc ccgagcagta tgtcttcaaa gcccgcaagg gcctcgatcg ggaggtcgtg       120
     gagcagatct cctggatcaa gaatgagccg gagtggatgc gcgagttccg gctcaaggca       180
     ctcgaatact ttctgcggcg cccgatgccg acctggggcg cggacctgtc cgaactgaac       240
     ttcgacgaga tcgtctatta catcaaacca accgagcgac agggtacgag ctgggaggaa       300
     ctgcccgagc acatccgccg cacgttcgat cggttgggta ttccggaagc cgagcggcgt       360
     ttcctcgctg gagtcggcgc ccagtacgag tcggaggtcg tctaccactc gctccgcgag       420
     gaactcaagc ggctcggcgt gatcttctgc gatatggaca cggccgtccg cgaatatccg       480
     gacctggtca agcagtactt cgggactatc gtgccaccaa acgacaacaa gttcgctgcc       540
     ctcaactcgg ccgtctggtc gggtggctcc ttcgtctatg tccccgaggg ggtgcgggtc       600
     gacgtaccgc tccaggccta cttccgcatc aatgccgaga acgtggggca gttcgagcgc       660
     acgctcatca tcgtcgagcc tggtgcctac gtccactacg tggaaggttg caccgctccg       720
     atttacagcg ctgcctcgct gcacagcgca gtcgtcgaga tcatcgtcaa agaaggtgca       780
     cgctgccggt acacgaccat ccagaactgg tcgaagaacg tgtacaacct cgtgaccaag       840
     cgagcagccg cgtaccgtga tgccaccatg gagtgggtgg atgggaatct cggctccaag       900
     gtcaccatga agtacccggc tgtgtggttg atggagccgg gcgcccgcgg tgaagtactc       960
     tcggtcgcct tcgctggtga tggtcagcac caggatgccg gcggcaagat ggtgcacgtc      1020
     gcaccgtaca cctcatccca gatcatctcc aagtcgatct ccaaagggac tggccgggcc      1080
     agttaccgcg gtttggtcaa ggtgcatcgc ggcgcccacc atgtgcgcgc caacgtggtg      1140
     tgcgacgcgc tcctgctcga cgagcagagc cgcacggata cctacccgta tatggagatc      1200
     gaagaggagc aggtgtcgat cggtcatgag gcaacggtga gcaaggtggc cgaggaacag      1260
     ctcttctacc tgcagagtcg ggggctcacc gaagccgagg cgatgagcat gatcgtcaac      1320
     ggcttcatcg agccgatcac gaaggaactg ccgctggagt acgcggtcga gctgaaccgg      1380
     ctgatcgcgc tcgagatgga aggttcagtc ggatga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page