(data stored in ACNUC30630 zone)

EMBL: CP001275.TRPD

CP001275.TRPD        Location/Qualifiers
FT   CDS_pept        112448..113494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="trd_0104"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05533"
FT                   /db_xref="GOA:B9KXB8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXB8"
FT                   /protein_id="ACM05533.1"
FT                   /translation="MIGSVLQKVVAGQILDIDEAMEAMSAIMTGEATPAQIAALVTALR
FT                   MRGERETEIAGFVKGLRAHMIPVELQLAQPVIDVVGTGGDGNRTFNISTATAFVVAGAG
FT                   VPVAKHGNRAMSSRAGSADVLEALGVRIDLNPSAVARCVEEAGIGFMFAQRFHPALRHA
FT                   APVRRELGFRTVFNVLGPLANPARVRYQLLGVAMPELVETVARVLALLDVEHALVVHSA
FT                   DGLDEISLGAPTTVYEVRRNGTVEVRRWTLEPESLGLERVPSDALRGGTAEENARIVRA
FT                   VLEGARGPARDVVLLNAAAALVAADAAQSLAEGLELARHAIDSGAALDRLERLKVLSNA
FT                   LAEAEVPS"
     atgatcggat cggtgctgca gaaggtcgtt gcaggccaga tcctggacat cgacgaggcg        60
     atggaggcga tgagcgccat catgacgggg gaggctaccc cagcacagat cgcggcgctg       120
     gtgaccgcac tccgcatgcg tggcgagcgt gaaaccgaga tcgctggctt cgtcaaaggg       180
     ctgcgagccc acatgatccc ggtggaactc cagcttgcgc agccggtcat cgatgtcgtg       240
     gggaccggtg gtgacgggaa ccggaccttc aacatctcca cggcgactgc tttcgtcgtt       300
     gctggtgcgg gggttccggt cgccaagcat ggcaaccggg cgatgtccag ccgagccgga       360
     tcggctgacg tcttggaggc attgggcgtc cggatcgacc tgaacccgag cgcggtggca       420
     cgctgtgtcg aggaggcagg gatcggcttc atgttcgccc agcgtttcca tcccgcgctg       480
     cggcatgcgg cgccggtgcg gcgagaactc ggctttcgaa cggtcttcaa cgtgctcggc       540
     cctctcgcga atccagcccg cgtgcgctac cagcttctcg gagtcgcgat gcctgaactc       600
     gtggagacgg tggcgcgggt tctcgccctg ctggatgtcg agcatgcgct ggtcgtccac       660
     tcggcggatg gtttggacga gatcagcctc ggcgcgccga cgacggtgta cgaggtccgg       720
     cgcaacggga cagtcgaggt ccgacgttgg acgctcgagc cagagtcgct cgggctcgag       780
     cgggttccca gcgatgcgct gcgtggcggc actgccgaag agaatgcgcg catcgttcgt       840
     gctgtcctgg agggagcgcg cggcccagca cgcgatgtgg tgttgctcaa cgcggctgcc       900
     gcgctcgttg cggcggacgc ggcgcagtcg ctcgccgagg gattggaatt ggctcgccac       960
     gcgatcgaca gtggtgccgc gctggaccgc ctggagcggc tgaaggtgct ctccaacgcg      1020
     ctggctgagg cggaggtgcc ctcgtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page