(data stored in ACNUC30630 zone)

EMBL: CP001275.TRPE

CP001275.TRPE        Location/Qualifiers
FT   CDS_pept        110224..111843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="trd_0102"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715; match to protein
FT                   family HMM TIGR00564"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05014"
FT                   /db_xref="GOA:B9L2C0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2C0"
FT                   /protein_id="ACM05014.1"
FT                   /translation="MTRTDAALRSPARRYHPSLEEVAVLAREATVIPIYRELDADLETP
FT                   VSAFLKVASEPYAFLLESVEGGERLARYSFIGTDPFLLVELDRGCARLRRTGTRTAFAA
FT                   PALASFGGADYYEPPTAEQVTTFSDPLRFLERLLARYRTVHLPGMPRFLGGAVGYLGYE
FT                   AIRYFEPRVPAAPRDTLGMPEAVFLLVDSMLVFDHLEHTIAVVSHVHVEEGISLAQAYA
FT                   DAVERIERLVDRLRRPPVIPFGPGPVDPESVEARLRPHVEPAQYVAMVERAKEYIAAGD
FT                   VIQVVLSQRQELETGAHPFTIYRALRRINPSPYMYFLRLGDDALIGASPEMLVRVDGRE
FT                   LSTHPIAGTRRRGRTPEEDAALAEELAADEKERAEHIMLVDLARNDIGRVAQPGTVHVP
FT                   RLMVVERYSHVMHLVSEVAGRLREDLSALDALRSCFPAGTVSGAPKVRAMEIIAELEPE
FT                   QRGPYAGAVGYVDFSGNLDTAITLRTIVMRGQRAFLQAGAGIVADSVPEFEHKECHHKM
FT                   RALVRAIEQAERLETEQRGGRA"
     atgacgagaa cggatgcagc tcttcgctcg ccagctcgcc gctatcaccc ctcactcgaa        60
     gaggtggcag tcctcgcgcg cgaagcgaca gtgatcccga tttatcgcga actcgacgct       120
     gacttggaga cacctgtgtc ggcgttcctc aaggtggcca gcgagcccta cgctttcctc       180
     ctggaaagcg tcgaaggtgg ggagcgtctc gctcgctatt ccttcatcgg gaccgatccg       240
     tttctgctcg tcgaactcga ccgcggctgc gcccgtctgc gccgtaccgg cacccgaacg       300
     gccttcgccg caccagccct cgcctcgttc ggcggtgcgg actattatga gcctcccacg       360
     gcggagcagg tgacgacctt cagcgatccg ctccgcttcc tcgagcgctt gctcgcacgt       420
     tatcggacag tccacctgcc gggcatgccg cgcttcctgg gtggggcggt cggctacctc       480
     ggttacgagg ccattcgcta tttcgagccg cgcgttcccg cagcaccgcg cgacacgctc       540
     ggaatgccgg aagcggtctt cctcctcgtc gactcgatgc tcgtcttcga tcatctcgag       600
     catacgatcg ccgtggttag ccacgtgcat gtggaagagg gaatatcgct cgcccaagca       660
     tacgctgacg cggtcgaacg gatcgagcgg ttggtcgatc gcttgcgccg gccaccagtc       720
     atcccgttcg gtcccgggcc ggttgacccg gaatcggtcg aggctcggct tcgcccgcac       780
     gtcgagcccg ctcagtacgt cgcgatggtc gagcgagcca aggagtacat tgcggctggc       840
     gacgtcatcc aggtggtcct ttcccagcgc caggaactgg agacgggtgc ccatccgttc       900
     acgatctacc gagcgctccg gcggatcaat ccatctccat acatgtactt tttgcgcctc       960
     ggtgacgatg cgctgatcgg tgcgtctccc gaaatgctcg tccgagtcga tggtcgcgag      1020
     ctttccaccc atccgatcgc cgggacgcga cggcgaggtc gcacaccgga agaagatgcc      1080
     gcattagcgg aagagctcgc tgccgacgaa aaggagcgtg ctgagcacat catgctcgtc      1140
     gatctggcgc gcaacgatat cggtcgtgtc gctcagcccg ggacagtgca tgtgccccgc      1200
     ctcatggtcg tcgagcggta cagtcacgtc atgcacctcg tcagcgaggt agctggccgg      1260
     ctccgcgagg acctgagcgc gctcgatgcg ctgcgtagct gtttcccggc cggaacggtc      1320
     agcggtgcgc cgaaggttcg cgccatggag atcatcgctg aactggaacc agaacaacgc      1380
     ggtccctatg cgggagccgt cggctacgtc gacttcagcg gcaacttgga taccgcgatt      1440
     acgctccgaa cgatcgtgat gcgaggccaa cgggcctttc tccaagcagg agcggggatc      1500
     gtcgctgata gcgtgccgga attcgaacac aaggaatgcc atcacaagat gcgggcactg      1560
     gtgcgcgcca tcgagcaggc cgaacgattg gaaaccgaac agcgaggagg tcgtgcatga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page