(data stored in ACNUC30630 zone)

EMBL: CP001275.TRPF

CP001275.TRPF        Location/Qualifiers
FT   CDS_pept        114303..114995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="trd_0106"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by match to protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05336"
FT                   /db_xref="GOA:B9KXC0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC0"
FT                   /protein_id="ACM05336.1"
FT                   /translation="MPGLVKLCGMRTPEDARAAIETGADLIGLVFAPSRRRVSLEEARA
FT                   ICRTVRESRNPPRIVGLFVDAPVDEIAMIASALELDLVQLHGNEPPEVLARLGWPALKA
FT                   IRLRPGESLEAACDRIAPYFSRERNPLAILLDAYHPSLLGGTGQIVDWTLAAELAARFP
FT                   IILAGGLRPETVAEAIALVRPLGVDVSSGIERDGHKDPQLMQAFVAAARRAFLTLDRPA
FT                   EIRIGGMR"
     atgccggggc tcgtgaaact ctgcggtatg cgaacgccgg aggacgcacg agcagcgatc        60
     gagaccggcg cggatctcat cggattggtc ttcgcgccga gccggcgtcg ggtttcgctc       120
     gaagaggctc gcgccatctg ccgaacggta cgggagtcgc ggaatccgcc gcgcatcgtt       180
     ggactcttcg tcgatgctcc cgtcgacgag atcgcgatga tcgcgagcgc gctcgagctc       240
     gatctcgtcc agctccacgg gaacgagccg ccagaggttc tcgcccggct cggttggcca       300
     gccctgaaag cgatccggct gcggccaggc gaaagcctgg aggcagcctg cgaccgcatc       360
     gcgccgtact tcagtcgaga acggaacccg ctcgcgatcc tgctcgatgc ctatcatccg       420
     tccctcttgg gtgggaccgg ccagatcgtc gactggacgc tggcagccga actcgctgcg       480
     cgctttccga tcatcttggc tggcggattg cgcccagaga cggtagcgga agcgatcgcg       540
     ctcgtccggc cgctgggtgt ggatgtttcc agcgggatcg agcgcgacgg gcacaaggac       600
     cctcagctga tgcaggcgtt cgtcgcggca gcgcgccgcg cgttcctgac cctcgatcga       660
     ccggcggaga tacggatcgg aggaatgcga tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page