(data stored in ACNUC7421 zone)

EMBL: CP001349.PE1

CP001349.PE1         Location/Qualifiers
FT   CDS_pept        1..1500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: met:M446_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55053"
FT                   /db_xref="GOA:B8ISZ1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ1"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL55053.1"
FT                   /translation="MRVDGSLAEGFDPGGGGSSGSGGGGDVAAAWQRVKRRLRAELGED
FT                   VFASWFARLELQEVSGGTARLTVPTRFLKSWIESHYLDRVLATFRSEADGVEGIEVGVR
FT                   GPMAPARAAPVGMAPAAPKAATPVRLAASAPAAAETAEADRAGRSEAADLSGAPLDPRL
FT                   TFQSFVVGRSNALAHAAAERVAAHDGGGPVYNPLYFHAGVGLGKTHLLHAIGHAAKEVG
FT                   RRVIYLTADRFMYGFVNALKTQNALAFKERLRAIDVLILDDVQFIQGRSIQAEFGHTLN
FT                   ALIDAGRQVVAAADRPPTELESLDERVRSRLAGGLVVEIGTLDEALRATILQSRLEAVR
FT                   ATHPAFEVSPAVAEYVAKAITANGRDLEGAVNRLLAHATLTGAPVTLETAETAIRDLVK
FT                   NREPKRVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVLTLRSLPEIG
FT                   RRFGGRDHTTVLHAVRKIEKAIGEDSALCDEVELLKRMLQD"
     atgcgtgtgg atggcagctt ggcggaaggg ttcgatccgg gcggcggcgg cagtagcggc        60
     agcggcggtg gcggcgacgt cgcggccgcg tggcagcggg tgaagcggcg cctgcgggcc       120
     gagctcggcg aggacgtgtt cgcgagctgg ttcgcgcggc tcgaactgca ggaggtctcc       180
     ggggggaccg cccgtctcac cgtgccgacc cgtttcctca agagctggat cgagtcccac       240
     tacctcgacc gggtgctcgc caccttccgc agcgaggccg acggcgtcga ggggatcgag       300
     gtcggcgtgc gcgggccgat ggcgcccgcc cgcgcggctc cggtcggcat ggcgcccgcc       360
     gctccgaagg cggccacgcc cgtgcggctg gccgcctccg ccccggccgc cgccgagacg       420
     gcggaggcgg accgggccgg ccgctccgag gccgccgatc tcagcggcgc acccctggat       480
     ccgcgcctca ccttccagag cttcgtggtc ggccgctcga acgcgctcgc gcatgcggcg       540
     gccgagcggg tcgcggccca tgacggcggc gggccggtct acaacccgct ctacttccat       600
     gcgggggtgg gtctggggaa gacgcatctc ctgcacgcga tcgggcatgc ggccaaggag       660
     gttgggcggc gggtgatcta cctcacggcc gaccgcttca tgtacggctt cgtcaacgcc       720
     ctgaagacgc agaacgcgct tgccttcaag gagcgtctgc gcgccatcga cgtgctgatc       780
     ctcgacgacg ttcagttcat ccagggccgc tcgatccagg ccgagttcgg ccatacgctg       840
     aacgccctga tcgatgccgg ccggcaggtc gtcgccgccg ccgaccggcc gccgaccgag       900
     ctggagagcc tcgacgagcg cgtgcgctcg cgccttgcgg gcggcctcgt ggtcgagatc       960
     ggcaccctcg acgaggccct gcgcgccacc atcctgcagt cgcgcctgga ggcggtgcgc      1020
     gccacgcacc cggccttcga ggtcagccct gccgtcgccg aatacgtcgc caaggcgatc      1080
     acggcgaatg gccgcgacct cgaaggggcg gtgaaccgcc tcctcgccca cgcgaccctg      1140
     acgggcgccc ccgtgaccct cgagaccgcc gagacggcga tccgcgacct cgtgaagaac      1200
     cgcgagccca agcgggtcaa gatcgaggac atccagaagc tggtggcgag ccgctacaac      1260
     gtctcgcgct ccgacattct ctcggagcgg cgcaccgccg ccgtggtgaa gccgcgccag      1320
     atcgccatgt atctctcgaa ggtgctgacg ctgcgctcgc tgccggagat cggccgccgc      1380
     ttcggcgggc gcgaccacac cacggtgctg catgcggtgc gcaagatcga gaaggcgatc      1440
     ggcgaggatt ccgccctctg cgacgaggtc gagctcctca agcgcatgct ccaggactga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page