(data stored in ACNUC7421 zone)

EMBL: CP001349.PE10

CP001349.PE10        Location/Qualifiers
FT   CDS_pept        13151..13489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0011"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: met:M446_0007 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55062"
FT                   /db_xref="GOA:B8IT00"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT00"
FT                   /inference="protein motif:TFAM:TIGR00365"
FT                   /protein_id="ACL55062.1"
FT                   /translation="MTDINTRIENEIKSQDVVVFMKGTPQFPMCGFSGQVAQILNYLGV
FT                   DYKGINVLEDMEIREGIKAYSNWPTIPQVYVKGEFVGGCDITREMFQSGELQQLLAERG
FT                   IAVKTAAA"
     atgaccgaca tcaacacccg catcgagaac gagatcaagt cacaggacgt ggtcgtgttc        60
     atgaagggca cgccgcaatt cccgatgtgc ggcttctcgg gtcaggtcgc tcagatcctc       120
     aattacctcg gcgtcgacta caagggcatc aacgtgctgg aggacatgga gatccgcgag       180
     ggcatcaagg cctattcgaa ctggccgacc attccgcagg tctacgtgaa gggcgagttc       240
     gtcggcggct gcgacatcac ccgcgagatg ttccagtcgg gcgagctgca gcagctgctc       300
     gccgagaggg gcatcgcggt gaagaccgcc gccgcctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page