(data stored in ACNUC7421 zone)

EMBL: CP001349.PE100

CP001349.PE100       Location/Qualifiers
FT   CDS_pept        110557..111354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0105"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bbt:BBta_0175 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55152"
FT                   /db_xref="GOA:B8IUA7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA7"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55152.1"
FT                   /translation="MSRLDGPAVAAAAERLWRHWQEGSRLDALPAAERPATRAEGYAIQ
FT                   ARMASLSRAPLFGWKIAATSAAGQAHIGVDGPLAGRLLAERVLDPQEEVPFRGNLMRVA
FT                   EAEIAFRMGQNLPPRAEPYDLASVLAAVDTVHPAIEFPDSRFADFVTAGGPQLIADNAC
FT                   AHLFVLGPPAPEWRDLDLVHLATRASLSGGPDHPGIGANVLGDPRIALVWLVNELSGLG
FT                   ITLQAGQVVTTGTTTVPIPIRPQSSLTADLGPLGRLTVRIGPG"
     gtgagccggc tcgacggccc ggcggtggcg gccgccgccg aacggctctg gcgtcactgg        60
     caggagggca gccgcctcga cgccctgccg gcggccgagc gccccgccac gcgggcggag       120
     ggctatgcca tccaggcgcg gatggcgagc ctgagccggg cgccgctctt cggctggaag       180
     atcgccgcca cgagcgcggc cggacaggct catatcggtg tcgacgggcc gctggccgga       240
     cgcctcctcg ccgagcgcgt gctcgatccg caggaggagg tgccgtttcg gggcaacctg       300
     atgcgggtcg ccgaagccga aatcgcgttt cggatggggc agaatcttcc gccgcgcgcc       360
     gagccctacg acctcgcctc cgtgctggcg gccgtcgaca ccgtgcatcc ggcgatcgag       420
     ttcccggatt cccgcttcgc cgatttcgtc acggccggcg gaccccagct catcgccgac       480
     aatgcctgcg cgcatctctt cgtgctgggc ccgccggcgc cagaatggcg cgacctggat       540
     ctggtccacc tcgcgacgcg ggcctcgctg tccggcgggc cggatcaccc ggggatcggc       600
     gcgaacgtgc tcggcgatcc gcgcatcgcc ctggtctggc tcgtgaacga actctccggc       660
     ctcggaatca cgctgcaagc cggacaggtg gtcacgaccg ggaccaccac ggtgccgatc       720
     ccgatccggc cgcagagttc gctgacggcc gatctcggcc ctctggggcg gctgacggtg       780
     cggatcgggc cgggatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page