(data stored in ACNUC7421 zone)

EMBL: CP001349.PE101

CP001349.PE101       Location/Qualifiers
FT   CDS_pept        complement(111374..111646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55153"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA8"
FT                   /inference="similar to AA sequence:KEGG:M446_4742"
FT                   /protein_id="ACL55153.1"
FT                   /translation="MKRSLLLASLVLGTVIAAGSVQAQGIPGGIRRGAAEGDRVAGPIG
FT                   GIVGGAVGGAVGGVNGVLGIDPGRRAYRTSLPGRRHHYRRHRHFR"
     atgaagcgct ctcttcttct ggcctccctg gttctcggga cggtcatcgc ggcgggaagc        60
     gtccaggcgc agggcatccc cggcggaatc cggcgcggcg ctgccgaggg cgaccgggtc       120
     gccggcccga tcggcgggat cgtgggcggt gcggtcggcg gcgcggtggg cggcgtgaac       180
     ggcgtgctcg gcatcgatcc cggccgccgg gcctaccgca ccagtctgcc ggggcgccgc       240
     catcactatc gccgccaccg gcatttccgc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page