(data stored in ACNUC7421 zone)

EMBL: CP001349.PE102

CP001349.PE102       Location/Qualifiers
FT   CDS_pept        complement(111795..113156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0107"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_4743 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55154"
FT                   /db_xref="GOA:B8IUA9"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA9"
FT                   /inference="similar to AA sequence:KEGG:M446_4743"
FT                   /protein_id="ACL55154.1"
FT                   /translation="MRFGRELVFLIGAVLLAGAAGLASYFTRATTLTIAVAPSGGTEPA
FT                   LIRAFADALASQHKSLRLTILPFDGVRESAAALQDGRADLAIVRPDILLPANGLTLAIL
FT                   REQAMIIAAPEPSGIKEMPDLSRKRLAFLAERTTDQAVLQRVLGHYGLALTTDPPPGPL
FT                   APRSVALVPLEEPDLATAFAEKRIDALAILTTPTTPTARRVMRIVQNASRTRKLRLAGV
FT                   AESSALIERFPRLQAVTVAEGLFAGHPKTPEEAVSTIGTSYRLMARSTLSRVAAAEVTQ
FT                   YLFEMRSLLAETVPSANAITAPAYETNAEATSARLPIHPGAIDYYEREQQSFIERYETW
FT                   IYLVAFLGGGVGSAVAWLRQRLSRLRRERIEVATRRLLQIRSEARRTTDRTALEEMAGE
FT                   IDDLAGNIARYALNRPTEAHTMTAATIAIDAARSTVQRALAQSGPPKPTLRAVE"
     atgcggttcg ggcgggagct ggtcttcctg atcggggcgg tgctcctcgc cggcgccgcc        60
     ggccttgcga gctacttcac gcgggcgacg acgctcacca tcgcggtcgc gccgagcggc       120
     ggcacggaac cggcgctgat ccgcgccttc gcggacgcgc tcgcaagcca gcacaagagc       180
     ctgcgtctca ccatcctgcc cttcgacggg gtgcgcgaaa gcgccgcggc cctgcaggac       240
     gggcgggcgg atctcgcgat cgtccggccc gacatcctgc tgcccgcgaa cggcctgacg       300
     ctcgcgatcc tgcgcgagca ggcgatgatc atcgccgccc ccgagccgtc cggcatcaag       360
     gagatgccgg acctgtcgcg caagcgcctg gccttcctcg ccgagcgcac cacggaccag       420
     gccgtcctgc agcgcgtcct cgggcattac gggctcgcgc tcacgaccga tccgccgccc       480
     ggccccttgg cgccgcgcag cgtggcgctg gtgccgttgg aggagccgga tctcgcgacc       540
     gccttcgcgg agaagcgcat cgacgcgctc gcgatcctca ccacgcccac gaccccgacc       600
     gccaggcggg tgatgcgcat cgtccagaat gcgagccgca cccggaagct gcgcttggcc       660
     ggcgtggcgg agagcagcgc cctcatcgag cggtttcccc gcctccaggc ggtgaccgtc       720
     gccgaagggc tgttcgccgg ccatccgaag acgcccgagg aggcggtgtc gacgatcgga       780
     acctcctacc ggctgatggc ccgctcgacg ctgtcgcgcg tcgccgccgc ggaggtcacc       840
     cagtacctct tcgagatgcg cagcctgctc gccgagacag tgccgtccgc gaacgccatc       900
     accgcgccgg cctacgagac gaatgcggag gcgacgagcg cccggctgcc catccatccg       960
     ggcgccatcg actattacga gcgcgagcag cagagcttca tcgagcgcta cgagacctgg      1020
     atctatctcg tcgccttcct gggcggcggc gtcggctcgg ccgtcgcatg gctgcgccag      1080
     cgcctctccc ggctgcggcg cgagcggatc gaggtggcga cgcgccgcct gctccagatc      1140
     cggtccgagg cgcgccgcac caccgaccgg acggccctcg aggagatggc cggcgagatc      1200
     gacgatctcg ccggcaacat cgcccgctac gcgctcaacc gcccgaccga ggcccacacc      1260
     atgacggcgg ccaccatcgc gatcgacgcg gcccgctcga ccgtgcagcg tgccctcgcg      1320
     cagagcgggc cgccgaagcc caccttgcgg gcggtggagt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page