(data stored in ACNUC7421 zone)

EMBL: CP001349.PE103

CP001349.PE103       Location/Qualifiers
FT   CDS_pept        complement(113187..113936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0108"
FT                   /product="ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM: Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: met:M446_4744 ubiquinone
FT                   biosynthesis O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55155"
FT                   /db_xref="GOA:B8IUB0"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB0"
FT                   /inference="protein motif:TFAM:TIGR01983"
FT                   /protein_id="ACL55155.1"
FT                   /translation="MSETTGPSIDRDEVARFERIAATWWDEAGPMRVLHRFNPVRITYI
FT                   RDTVCRHFGRDPRRPLPLEALSLIDIGCGGGILSEPLARLGATVTGLDPAPTNIRVAQA
FT                   HAAEAGVPVDYRGQTIEAVVEAGERFDVVLAMEVVEHVVDMPAFVRTACAAVKPGGLFF
FT                   AATLNRTMRSFALAIVGAEYVLGWLPRGTHDWEKFVTPAELTGAVESAGLTVIDTTGVV
FT                   YNPLGGRWAMSRDTGVNYMIAAERPVA"
     atgagcgaga ccaccggccc ctcgatcgac cgcgacgagg tcgcccgctt cgagcgcatt        60
     gcggccacct ggtgggacga ggcggggccg atgcgggtgc tccaccgctt caatcctgtc       120
     cgcatcacct atatccgcga cacggtctgc cggcatttcg gccgcgaccc gcgccggccg       180
     ctccccctcg aagccttgag cctcatcgat atcggctgcg gcggcggcat cctgtcggag       240
     ccgctggcgc gcctcggcgc caccgtcacc ggcctcgacc cggccccgac caacatccgg       300
     gtggcgcagg cccatgcggc ggaggccggc gtgccggtgg attaccgcgg ccagaccatc       360
     gaggcggtgg tggaggcggg ggagcgcttc gacgtggtgc tcgccatgga ggtggtggag       420
     cacgtcgtcg acatgcccgc cttcgtgcgg acggcctgcg cggccgtgaa gcccgggggc       480
     ctgttcttcg cggccacgct caaccgcacc atgcgctcct tcgccctcgc catcgtcggc       540
     gccgaatacg tgctcggctg gctgccgagg gggacgcacg actgggagaa gttcgtcacg       600
     ccggccgagc tcaccggggc ggtggagagc gcggggctca ccgtcatcga cacgactggg       660
     gtcgtctaca atccgctcgg cggtcgctgg gccatgtccc gcgacacggg ggtgaactac       720
     atgatcgcgg cggagcggcc ggtcgcctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page