(data stored in ACNUC7421 zone)

EMBL: CP001349.PE105

CP001349.PE105       Location/Qualifiers
FT   CDS_pept        114128..115363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0110"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   met:M446_4746 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55157"
FT                   /db_xref="GOA:B8IUB2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB2"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACL55157.1"
FT                   /translation="MPRLVMKFGGTSVATVDRIRNVARHVAREVRAGYEVAVVVSAMAG
FT                   KTNELVAWCKDASPLYAQSEYDAVVASGEQVTSGLLAIVLAEMGIKARSWQGWQIPIET
FT                   SDQHGSARIARIDGSRLDAGFRHGEVAVIAGFQGIHAETGRLTTLGRGGSDTSAVAVAA
FT                   AIGAERCDIYTDVDGVYTTDPRVVPKARRLERVAFEEMLEMASLGAKVLQVRSVELAMV
FT                   HRVPTTVRSSFDDPDDARPGTLICDEDDIVEQQIITGIAFSKDEAQITLRRVKDRPGVA
FT                   AAIFGPLADANINVDMIIQVVSGDGVTTDMTFTVPASDYERARTILDAQSGKVEFERIE
FT                   GATDVVKISAIGVGMRSHAGVAAKAFRALADKGINIRAITTSEIKFSVLIDAAYTELAV
FT                   RTLHSLYGLDRA"
     atgcctcgcc tggtgatgaa gttcggcggc acgtccgtcg ccacggtcga ccgcatccgc        60
     aacgtcgccc gccatgtcgc ccgcgaggtg cgggccggct acgaggtcgc ggtcgtggtc       120
     tcggccatgg ccggcaagac caacgaactc gtggcctggt gcaaggacgc ctcgccgctc       180
     tacgcgcagt cggaatacga cgcggtcgtg gcgtcgggcg agcaggtcac ctccgggctc       240
     ctcgccatcg tgctcgccga gatgggcatc aaggcccgct cctggcaggg ctggcagatc       300
     ccgatcgaga cctcggacca gcatggctcg gcgcgcatcg ccaggatcga cgggtcgcgc       360
     cttgatgccg gcttccggca cggcgaggtc gcggtgatcg ccggcttcca gggcatccac       420
     gcggagacgg gccgcctcac gacgctcggg cgcggcgggt cggataccag cgcggtcgca       480
     gtcgcggcgg cgatcggcgc ggagcgctgc gacatctaca ccgacgtcga cggcgtctac       540
     accaccgatc cgcgggtggt gccgaaggcg cggcggctgg agcgcgtcgc cttcgaggag       600
     atgctggaga tggcctcgct cggcgccaag gtgctgcagg tgcgctcggt cgaactcgcc       660
     atggtgcacc gggtgccgac caccgtgcgc tcctccttcg acgaccccga cgacgcccgg       720
     cccggcaccc tcatctgcga cgaggacgac atcgtggaac agcagatcat cacgggcatc       780
     gccttctcga aggacgaagc ccagatcacg ctccgccggg tgaaggacag gcccggcgtc       840
     gccgccgcca tcttcggccc gctcgccgac gccaacatca acgtcgatat gatcatccag       900
     gtcgtgtcgg gcgacggcgt gaccaccgac atgaccttca cggtgccggc gagcgattac       960
     gagcgcgccc gcacgatcct ggacgcccag tccggcaagg tcgagttcga gcgcatcgag      1020
     ggcgccaccg acgtggtgaa gatctcggcg atcggcgtcg gcatgcgcag ccacgcgggc      1080
     gttgccgcca aggccttccg ggcgcttgcc gataagggca tcaacatccg ggcgatcacc      1140
     acctcggaga tcaagttctc cgtgctgatc gacgcggcct atacggaact cgccgtgcgc      1200
     accctgcact cgctctacgg gctcgacagg gcctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page