(data stored in ACNUC7421 zone)

EMBL: CP001349.PE106

CP001349.PE106       Location/Qualifiers
FT   CDS_pept        115536..117797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0111"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein; GAF domain
FT                   protein; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: met:M446_4747
FT                   phosphoenolpyruvate-protein phosphotransferase PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55158"
FT                   /db_xref="GOA:B8IUB3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB3"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACL55158.1"
FT                   /translation="MPAAPGGPRLLLRRLREAMAEPVSAQARLDRIVVIIAANMVAEVC
FT                   SVYVLRDDGMLELFATEGLNREAVHLTTMRAGEGLVGLIAASAEPLSLSDAQSHPAFSY
FT                   RPETGEEIYHAFLGVPLLRAGNTMGVLVVQNRTYRVYSEEEIEALQTTAMVLAEMIASG
FT                   DLQALSPGTVNATRRSLSQSGVALAEGVGLGHVVLHEPRIVVKNLIAENVEREVGRLET
FT                   AIAEVRSAIDDLVERGDVAGAGEHREVLETVRMFAHDQGWLRRMREAVLSGLTAEAAVE
FT                   RVQSDNRARMLRQSDPYLRERLHDLDDLANRLLRQLVGAQGMIPGTMPENAILVARSMG
FT                   PAALLDYDRARLRGVVLEEGGPTSHIAIVARALGIPAVGEVANATALVESGDAIIVDGG
FT                   AGEVQIRPGPEVEAAYAEKARLRARRQEQYRALRDLPSVTRDGVGIALQLNAGLLVDLS
FT                   HLNETGAEGVGLFRTELQFMVAERMPSAAEQQSLYEAVFAAAGDLPVTIRTLDIGGDKI
FT                   LPYMKALEEENPALGWRAIRIGLDRPGLLRMQLRALLKAAGGRPLKIMFPMVATVDEFI
FT                   RAKAIVDREKAHLARHGRPLPSDCRLGVMVEVPSLLFQMDEIAAAADFLSVGSNDLMQF
FT                   LFAVDRENRQVANRFDPLCAAALRAFGLIAERAQAAGTPVTVCGEIGGRPLEAMALIGL
FT                   GYRALSMSPASIGPVKAMVLSLDAAKIGAFLRDELAKTSDGASLRPALAAYAEAHGIPV
FT                   "
     atgcccgctg cgcctggagg tccgcgcctg cttctgcgcc gcctccgtga agccatggcg        60
     gagccggtca gcgcgcaggc gcgtctcgac cgcatcgtcg tcatcatcgc ggccaacatg       120
     gtcgcggagg tgtgttccgt ctacgtcctg cgggacgacg ggatgctgga gctcttcgcg       180
     accgagggcc tcaaccgcga ggcggtccat ctcaccacca tgcgcgccgg cgagggcctc       240
     gtcggcctga tcgcggccag cgccgagccc ctctcgctct ccgacgcgca gtcccacccg       300
     gccttctcgt accggccgga aaccggcgag gagatctacc acgccttcct gggcgtgccg       360
     cttctgcggg ccggcaacac gatgggcgtc ctcgtcgtcc agaaccggac ctaccgggtc       420
     tattccgagg aggagatcga ggcgctccag accaccgcca tggtgctggc ggagatgatc       480
     gcctcgggcg acctgcaggc gctctcgccc gggacggtca acgccacgcg ccgatccctg       540
     tcccagagcg gagtcgcgct cgccgagggt gtcgggctcg ggcatgtggt gctgcacgag       600
     ccgcgcatcg tggtgaagaa cctcatcgcc gagaatgtcg agcgggaggt ggggcggctc       660
     gagaccgcca tcgcggaggt gcgctccgcg atcgacgatc tcgtcgagcg cggcgacgtg       720
     gccggcgcgg gcgagcaccg cgaggtgctg gagaccgtgc gcatgttcgc ccacgaccag       780
     ggctggctgc gccggatgcg cgaggcggtc ctgtcggggc tgacggccga ggcggcagtc       840
     gagcgggtgc agtcggacaa ccgcgcccgc atgctgcgcc agagcgatcc ctatctgcgg       900
     gagcgcctgc acgatctcga cgatctcgcc aaccgtctcc tgcgccagct cgtgggcgcg       960
     caaggaatga tcccgggcac gatgcccgag aacgccatcc tggtcgcgcg ctccatgggg      1020
     ccggccgcac tcctcgacta cgaccgcgcg cggctgcgcg gcgtcgtgct ggaggaaggc      1080
     ggcccgacga gccacatcgc catcgtggcc cgtgcgctcg gcatcccggc cgtgggcgag      1140
     gtggcgaacg cgaccgcgct cgtcgaatcg ggcgacgcca tcattgtgga tggcggcgcg      1200
     ggcgaggtgc agatccgacc gggcccggag gtcgaggctg cctatgccga gaaggcgcgc      1260
     ctgcgcgccc ggcgccagga gcagtaccgg gccctgcgcg acctgccctc cgtcacccgc      1320
     gacggggtgg gaatcgcgct ccagctcaat gcgggcctcc tcgtcgacct ctcgcacctg      1380
     aacgagaccg gcgccgaggg cgtcgggctg ttccgcaccg agctccagtt catggtcgcc      1440
     gagcgcatgc cctcggcggc cgagcagcag agtctctacg aggcggtctt cgcggccgcg      1500
     ggcgacctgc cggtgacgat ccgcaccctc gacatcgggg gcgacaagat cctgccctac      1560
     atgaaggcgc tggaggagga gaacccggcg ctcggctggc gggcgatccg catcggcctc      1620
     gaccggccgg gcctgctgcg catgcagctg cgtgccctcc tcaaggcggc gggcgggcgc      1680
     ccgctcaaga tcatgttccc gatggtcgcg accgtggatg agttcatccg cgccaaggcg      1740
     atcgtcgacc gggagaaggc gcatctcgcc cgccacggcc gtcccctccc ctcggattgc      1800
     cgcctcggcg tgatggtcga ggtgccctcg ctgctgttcc agatggacga gatcgcggcg      1860
     gcggcggatt tcctctcggt cggttcgaac gacctgatgc agttcctgtt cgcggtcgac      1920
     cgcgagaacc ggcaggtcgc caaccgcttc gatccgctct gcgccgctgc gcttcgcgcc      1980
     ttcgggctga tcgccgagcg ggcgcaggcg gcgggcacgc ccgtcacggt ctgcggcgag      2040
     atcggcgggc gcccgctcga ggccatggcg ctcatcggcc tcggctaccg ggcgctctcc      2100
     atgtccccgg cctcgatcgg gccggtcaag gccatggtgt tgagcctcga cgcggcgaag      2160
     atcggcgcct tcctgcggga tgagctcgcc aagacgagtg acggcgcgtc cctgcggccg      2220
     gccctggccg cttatgcgga ggcccatggc atcccggtct ga                         2262
//

If you have problems or comments...

PBIL Back to PBIL home page