(data stored in ACNUC7421 zone)

EMBL: CP001349.PE107

CP001349.PE107       Location/Qualifiers
FT   CDS_pept        117995..119074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0112"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   met:M446_4748 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55159"
FT                   /db_xref="GOA:B8IUB4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB4"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACL55159.1"
FT                   /translation="MIAIPSDRLDAILARHDIVTATLSAGEADSESFVQLSRELSDLDD
FT                   VVAAIRAYRAADAELRGVEAMLEEGDPEMRALAAEEKPEVEAARDAAAKALQILLLPKD
FT                   SADEKSAILEIRAGTGGDEAALFAGDLFRMYARYADLKGWKVEVVSESPGTMGGYREVV
FT                   AEVKGRGVFARLKFESGAHRVQRVPETETQGRIHTSAATVAVLPEAEEVDIHVNEADLK
FT                   IDTMRAQGAGGQHVNKTESAIRITHMPSGIVVFVQEERSQHKNRARAMAVLRARLYEQE
FT                   RSQKDAARAADRRAQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLEEVLAGTALDEL
FT                   VDALVTEHQAALLAAEGLG"
     atgatcgcca taccctccga ccgactcgat gccatcctgg cgcggcacga catcgtgacc        60
     gcgactctca gcgcgggcga ggccgattcc gagagcttcg tccagctctc gcgcgaactc       120
     tccgacctcg acgacgtcgt ggcggcgatc cgcgcctacc gggccgccga tgcggagctg       180
     cgcggcgtcg aggcgatgct ggaggagggc gatcccgaga tgcgggcgct cgcggccgag       240
     gagaagcccg aggtcgaggc cgcccgcgac gccgccgcca aggcgctcca gatcctgctc       300
     ctgccgaagg attccgccga cgagaagagc gccatcctgg agatccgggc cggcaccggc       360
     ggcgacgagg cggcgctctt cgcgggcgac ctgttccgca tgtatgcccg ctacgccgac       420
     ctgaagggct ggaaggtcga ggtggtctcg gagagccccg gcaccatggg cggctaccgg       480
     gaagtggtgg cggaggtgaa gggccgcggc gtcttcgcgc ggctgaaatt cgagagcggc       540
     gcccaccggg tccagcgcgt gcccgagacc gagacgcagg ggcgcatcca cacctcggcg       600
     gcgaccgtgg cggtgctgcc ggaggccgag gaggtggaca tccacgtcaa cgaggccgat       660
     ctcaagatcg acaccatgcg ggctcagggc gccggcggcc agcacgtcaa caagacggaa       720
     tcggccatcc gcatcaccca tatgccgagc ggcatcgtgg tcttcgtcca ggaggagcgc       780
     tcccagcaca agaaccgcgc ccgcgccatg gcggtgctgc gtgcccgcct ctacgagcag       840
     gagcgcagcc agaaggacgc ggcccgcgcc gccgaccgcc gcgcccaggt cggcagcggc       900
     gaccgctccg agcgcatccg cacctacaac ttcccgcagg ggcgcgtcac cgaccaccgg       960
     atcaacctga ccctgtacaa gctggaggag gttctggccg ggaccgccct cgacgagctc      1020
     gtcgacgcgc tggttaccga gcatcaggcg gccctgctcg ccgccgaggg actcgggtga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page