(data stored in ACNUC7421 zone)

EMBL: CP001349.PE108

CP001349.PE108       Location/Qualifiers
FT   CDS_pept        119071..119970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0113"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   met:M446_4749 protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55160"
FT                   /db_xref="GOA:B8IUB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB5"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACL55160.1"
FT                   /translation="MSEPVRAGLSRAAAQSHAAAFLAGRGIATAMRDARLLLIETLNLR
FT                   SIDLVLAGDRELEAREAARLSAALLRRAEGEPVARILGAWEFWGLPFRLSPATLVPRPD
FT                   TETVVEAALALGLERTAPIRLLDLGTGSGCLLVALLSEWPCATGLGIDRAREALVTARD
FT                   NADQNGVGARALWVQGDWAGSLRGPFDVIVANPPYIASRMIDGLADEVRVHDPRMALDG
FT                   GSDGLDAYRVILGQAAVLLAPGGRLIVEIGYDQEEALRHLAEAARLQVVVVRRDLAGHP
FT                   RAVVMAREPGRNPDSSGF"
     gtgagcgagc ctgtccgggc cggcctcagc cgggccgcgg cgcagtctca cgccgccgcg        60
     ttcctcgccg ggcggggcat cgcgacggcc atgcgcgatg cccggctgct cctcatcgag       120
     acgctgaacc tgcggagcat cgatctcgtc ctcgccggcg accgggagct ggaggcgcgg       180
     gaggccgccc gcctctcggc ggcgctcctg cgccgcgcgg aaggagaacc cgtcgccagg       240
     atcctcggag cctgggaatt ctggggcctg cccttccgcc tctcccccgc gacgctggtg       300
     ccccgcccgg acaccgagac cgtcgtcgag gccgccctcg ccctcggcct ggagcggacc       360
     gcgccgatcc gcctgctcga tctcggcacg ggctcgggtt gcctcctcgt cgcgctgctg       420
     agcgagtggc catgcgccac gggcctcggc atcgaccgcg cgcgcgaggc gctcgtcacc       480
     gcccgcgaca atgcggacca gaacggcgtc ggcgcccgcg cgttatgggt gcaaggcgat       540
     tgggccgggt cgctgcgcgg gcccttcgat gtaattgtcg cgaatccgcc ctatatcgcg       600
     agcaggatga tcgacgggct cgccgacgaa gtccgtgtcc acgatcccag gatggccctc       660
     gatggcggct ccgatggact cgatgcctac cgcgtcatcc tcgggcaagc cgccgttctg       720
     ctggcgcccg gggggcggct gattgtcgag atcgggtatg atcaagagga ggcgctgcgt       780
     catctcgccg aggcggcgag gcttcaggtt gtggttgtgc gccgcgacct ggcggggcat       840
     ccgcgtgccg tggtgatggc ccgggagccg ggccgcaacc cggattcctc aggtttctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page