(data stored in ACNUC7421 zone)

EMBL: CP001349.PE109

CP001349.PE109       Location/Qualifiers
FT   CDS_pept        120329..121264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55161"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB6"
FT                   /inference="similar to AA sequence:KEGG:M446_4750"
FT                   /protein_id="ACL55161.1"
FT                   /translation="MRPNQNRRMRGRNRNKGPNPLTRAYESNGPDVKIRGTAQHIAEKY
FT                   AQLARDAQANGDPVMAENYFQHGEHYQRIIAAANEQYRQQFGGFRPSFEEDEEGEDEAP
FT                   QTNGYAAGPENRGGNGYTPNGYGQAEDYVDPSQQPQPYETRGERDDRPARFDRQQDRRD
FT                   RFQNRDRPQRQDRQQDRQQDRPERQGEPRQDFRGEQPRQDGYREGGGRGEFRRERPERP
FT                   RREESRPELPAAEEPGLPAFLTNPVRPAPAPAPVPAPVEEHAPVAPPAEAAEPPARPRR
FT                   RRRTRYETQEGAEGGSDLFPPKAPADTPSE"
     atgagaccaa accagaaccg gcgtatgcgt ggccgcaacc gcaacaaggg cccgaatccg        60
     ctcaccaggg cctatgaatc gaacggtccc gacgtcaaga tccgcggcac ggcccagcac       120
     atcgccgaga aatacgccca gctcgcgcgc gacgcccagg cgaacggcga tccggtgatg       180
     gcggagaact atttccagca cggcgagcac taccagcgca tcatcgccgc cgccaacgag       240
     cagtaccggc agcagttcgg tggcttccgc ccgtccttcg aggaggacga ggagggcgag       300
     gacgaggccc cgcagaccaa cggctacgcg gccggcccgg agaatcgcgg cggcaacggc       360
     tacaccccga acggctacgg ccaggcggag gattacgtcg atccctcgca gcagccccag       420
     ccctacgaga cccgcggcga gcgcgacgac cgtccggccc gcttcgaccg gcagcaggat       480
     cggcgggacc gcttccagaa ccgcgaccgg ccccagcgcc aggaccgcca gcaagatcgc       540
     cagcaggacc ggccggagcg ccagggcgag ccgcgccagg atttccgcgg cgagcagccc       600
     cgtcaggacg gctaccgcga gggcggcggc cgcggcgagt ttcgccgcga gcgcccggag       660
     cggccgcgcc gcgaggagtc gcggcccgaa ctgcccgccg ccgaggagcc cggcctgccg       720
     gcctttctga ccaatccggt ccggcccgcc ccggctccgg cgccggtccc ggcccccgtc       780
     gaggagcacg caccggtcgc gccgcccgcc gaggccgcgg agccgccggc gcgtccgcgg       840
     cgtcggcgcc gcacgcgcta cgagacccag gaaggcgctg agggcggaag cgatctcttc       900
     ccgcccaagg ctccggcgga cactccctcg gaatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page