(data stored in ACNUC7421 zone)

EMBL: CP001349.PE11

CP001349.PE11        Location/Qualifiers
FT   CDS_pept        13608..14507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0012"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   met:M446_0008 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55063"
FT                   /db_xref="GOA:B8IT01"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT01"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACL55063.1"
FT                   /translation="MRDVIIVGGGPAGLSAALVLARCRRTVLLIDAGHPRNAVTARMNG
FT                   YLGHDGCPPGELRATARAELARYPSVECRDGEATDARREEDGFTVVLADGRTERARRLI
FT                   LATGLATELPPVEGFAEFWGHGVHHCPYCDGYENRDAPVVVYGRGGSGKGLALELTSWT
FT                   RDLVLCTDGPAEELSASDRDRLARQRIRIDERPVARLEGEDGRPVRLRFADGDALPCRA
FT                   LFFAPAACAPSPLVERIGCDLTPKGTVPTRDYEQSNVPGLYVAGDASRRVQFAIVAAAE
FT                   GAMAAFAINTELLQEDTR"
     atgcgcgacg tgatcatcgt gggcggcggg cccgcgggcc tgagtgcggc cctggttctg        60
     gcccggtgcc gccgcacggt gctgctcatc gatgccgggc atccgcgcaa cgccgtgacg       120
     gcgcggatga acggctatct cggccatgac ggctgcccgc cgggcgagct gcgcgcgacc       180
     gcccgggcgg agctggcgcg ctatccgagt gtcgaatgcc gcgacggcga ggcgacggat       240
     gcgcgccgcg aggaggacgg cttcacggtc gtcctggcgg atggccgcac ggaacgggcc       300
     cgccgcctca tcctcgccac tggactcgcc accgagctgc cgccggtcga gggcttcgcg       360
     gagttctggg gccatggcgt ccaccattgc ccctattgcg acggttacga gaaccgggac       420
     gcgcccgtcg tcgtctacgg gcgcggcggg agcggcaagg gcctcgccct cgaactcacc       480
     agctggaccc gggacctcgt cctctgcacg gacggtccgg cggaggagct gtcggcgtcc       540
     gatcgcgacc ggctcgcgcg tcagcgcatc cgcatcgacg agcggccggt ggcgcgcctc       600
     gaaggcgagg acggacgccc ggtccgcctc cgcttcgcgg atggcgatgc cctgccctgc       660
     cgtgccctgt tcttcgcgcc cgccgcctgc gccccctccc cgctcgtcga gcggatcggc       720
     tgcgacctga cgccgaaggg cacggtgccg acccgcgact acgagcagtc gaacgtgccg       780
     ggcctctacg tggcggggga cgcctcgcgc cgcgtgcagt tcgccatcgt ggccgcggcc       840
     gagggcgcga tggccgcctt cgcgatcaat accgagcttc ttcaagagga tacgcgctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page