(data stored in ACNUC7421 zone)

EMBL: CP001349.PE110

CP001349.PE110       Location/Qualifiers
FT   CDS_pept        121317..122450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0115"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   met:M446_4751 sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55162"
FT                   /db_xref="GOA:B8IUB7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACL55162.1"
FT                   /translation="MSQVFDVIVLGVGGMGSATCWHLARRGQRVLGLERFDIPHAMGSS
FT                   HGVNRIIRLAYFEHPSYVPLLRRAYANWREAEVLFGEPLLFITGSVDAGPAQSRVVAGA
FT                   VDACRLHDLPHELLPARELNARFPGYALPEGHLALLQPEGGFVASERAIVAHVALAQGA
FT                   GAEIRARERALGWEPTAAGGVRVRTERGTYEAGRLVLAAGAWMQDFVPALAGRAVPERQ
FT                   VLGWFQPTQPAAFALGRFPVFNALFDEGHFYGFPVWGLPGFKIGLYHHLRETGPAETID
FT                   REVHPRDEALLRQALRRYFPQADGPTMALRTCLFTNTPDEHFVLDTLPDLSQVVVASPC
FT                   SGHGYKFCSVIGEILADLATTGETRFDIGLHGLARLG"
     gtgtcgcaag tcttcgacgt gatcgtgctc ggtgtcggcg ggatgggctc tgccacctgc        60
     tggcacctcg cccgtcgcgg ccagcgggtg ctggggctgg agcggttcga catcccccac       120
     gccatgggct cgtcccacgg ggtgaaccgc atcatccgcc tcgcctattt cgagcatccg       180
     tcctacgtgc cgctgctgcg ccgcgcctat gccaactggc gcgaggcgga ggtgctgttc       240
     ggcgagccgt tgctcttcat caccggctcg gtcgatgccg gccccgcgca gagccgcgtc       300
     gtcgcgggcg ccgtcgacgc gtgccggctg cacgatctcc cgcacgagct cctcccggcg       360
     cgggagctga acgcgcgttt ccccggctat gcgctgccgg aggggcacct cgccctcctg       420
     cagccggagg gcggcttcgt cgcctccgag cgcgcgatcg tggcccatgt cgccctggcg       480
     cagggcgcgg gggcggagat ccgcgcgcgg gagcgggcgc tcggctggga gccgaccgcc       540
     gccggcgggg ttcgggtgcg cacggagcgc ggcacctacg aggccggacg gctcgtcctc       600
     gcggcggggg cctggatgca ggatttcgtc ccggcgctcg ccgggcgcgc cgtgccggag       660
     cggcaggttc tcggctggtt ccagccgacg cagcccgccg cctttgcgct cggccggttt       720
     ccggtcttca atgccctgtt cgacgagggg catttctacg gcttcccggt ctgggggctg       780
     ccgggcttca agatcggtct ctaccatcat ctgcgcgaaa ccgggccggc cgagaccatc       840
     gaccgggagg tgcatccccg cgacgaggcg ctgctgcggc aggcgctgcg gcgctacttc       900
     ccgcaggccg acggcccgac catggcgctg cgcacctgcc tgttcaccaa cacgcccgac       960
     gagcatttcg tcctcgacac cctgccggac ttatcccagg tggtcgtcgc ctcgccctgc      1020
     tcgggccacg gctacaagtt ctgcagcgtg atcggcgaga tcctggccga tctcgccacg      1080
     accggggaga cgcgtttcga catcggcctg cacgggctgg cccgtctcgg gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page