(data stored in ACNUC7421 zone)

EMBL: CP001349.PE111

CP001349.PE111       Location/Qualifiers
FT   CDS_pept        122557..123213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0116"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sme:SMb20033
FT                   hypothetical transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55163"
FT                   /db_xref="GOA:B8IUB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55163.1"
FT                   /translation="MAGSSRAERAEGMRGHDPERTKADIVTVATEEFAENGLSGARVDA
FT                   IAERTRTSKRMIYYYFGSKEGLYLAVLERAYAEIRALEAGLDLERCDPVEGLRRLIGQT
FT                   FDSDEAHAAFIRLVTIENIHKAKHLAGMESIRQINRRVIALIDDLLARGRADGRFRTDV
FT                   DAVDVHMMISALCFFRVANRHTFGAIFDVDLFAPERRAKHRQLIADAVVRALAPT"
     atggcgggat cgtcgcgcgc ggagcgcgca gaggggatgc gcggtcacga tccggagcgc        60
     accaaggccg atatcgtcac ggtggcgacg gaggaattcg ccgagaacgg cctgagcgga       120
     gcccgcgtcg acgccatcgc ggagcgcacg cgcacctcca agcgcatgat ctactactat       180
     ttcggcagca aggaggggct ctaccttgcg gttctggagc gcgcctatgc ggagatccgg       240
     gctctcgagg cggggctcga cctggagcgc tgcgatcccg tcgagggcct gcgccgcctg       300
     atcggccaga ccttcgattc ggacgaggcg catgccgcct ttatccgcct cgtcaccatc       360
     gagaacatcc acaaggccaa gcatctcgcc gggatggagt cgatccgtca gatcaatcgg       420
     cgggtcatcg ccctgatcga cgaccttctg gcccgcgggc gcgccgacgg ccgcttccgg       480
     accgacgtcg atgccgttga cgtccacatg atgatcagcg cgctgtgctt ctttcgggtg       540
     gcgaaccggc acaccttcgg ggcgatcttc gatgtcgatc ttttcgcgcc ggagcggcgg       600
     gcgaaacatc ggcagctgat cgcggatgcg gtcgtgcggg cgctcgcgcc tacctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page