(data stored in ACNUC7421 zone)

EMBL: CP001349.PE112

CP001349.PE112       Location/Qualifiers
FT   CDS_pept        complement(123605..124939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0117"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: sma:SAV1779
FT                   3-(2-hydroxyphenyl) propionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55164"
FT                   /db_xref="GOA:B8IUB9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55164.1"
FT                   /translation="MSVHAVEAGAIAPAIPPAATAAPRKAALASWIGSAVEYYDFFIYG
FT                   AAASLIFPKLFFSPDNPQAALMLSFATFGVAYIARPFGAIGLGHIGDRFGRKRVLTFTL
FT                   LLMGFSTFIIGCLPTYAQAGLLAPTLLVLARFMQGISAAGEQAGANSMTLEHAPADQRA
FT                   FFTSFTLSGTQAGLILANLVFLPITALPEEQLLSWGWRIPFFLSALVVAVGFWVRRSLP
FT                   ETPVFEEEKAQHKEAALPVVTLFRTQSADLLRVIFAALVSVVSTIGANYVLAYAVREVK
FT                   ISQPTTLLVLILANVVALAAIPLWAKLADRIGRRPVFIAGSLGSAVTVWPLFWAVSTGN
FT                   VPLMFVFGVLLSGVVYSAANGVWPSLYGEMFDTRVRLSGMAIGTQIGFALGGFAPTIAA
FT                   AIQGSGPTGWYPVAAFVTVTCLISAFSVYTARETYRTPLHALGRR"
     atgtccgtcc acgccgttga ggccggtgcc atcgcacccg ccatcccccc tgccgccacc        60
     gcggcgccgc gcaaggccgc gctcgcgagc tggatcggca gcgccgtcga gtactacgac       120
     ttcttcatct acggggcggc cgcctcgctg atcttcccaa aactgttctt ctcgccggac       180
     aatccgcagg cggccctgat gctgtccttc gcgactttcg gcgtcgccta tatcgcgcgg       240
     cccttcgggg cgatcggcct cggccatatc ggcgaccggt tcggccgcaa gcgggtgctc       300
     accttcacgc tcctgctgat gggcttctcc accttcatca tcggctgcct gccgacctat       360
     gcgcaggccg ggctgctcgc gccgacgctc ctcgtcctcg cccgcttcat gcagggcatc       420
     tcggcggcgg gcgagcaggc cggcgccaac tcgatgacgc tcgaacacgc gcccgcggat       480
     cagcgcgcct tctttacgag cttcacgctc agcggcaccc aggccggcct gatcctcgcc       540
     aatctcgtat tccttcccat caccgccctg ccggaggagc agctgctgtc ctggggctgg       600
     cgcattccct tcttcctcag cgccctcgtg gtcgcggtgg gcttctgggt gcgccgcagc       660
     ctgccggaga cgcctgtctt cgaggaggag aaggcgcagc acaaggaggc cgcgctgccg       720
     gtggtgaccc tgttccgcac gcaatcggcg gatctgctgc gggtcatctt cgcggcgctc       780
     gtctcggtgg tcagcacgat cggcgcgaac tacgtgctcg cctatgcggt gcgtgaggtg       840
     aagatctcgc agcccacgac cctgctcgtc ctcatcctgg cgaatgtggt ggcgctcgcg       900
     gcgatcccgc tctgggcgaa gctcgccgac cgcatcggcc gcaggcccgt cttcatcgcc       960
     ggctccctcg gctcggccgt gaccgtgtgg ccgctgttct gggcggtctc gaccggcaac      1020
     gtgccgctga tgttcgtgtt cggggtcctg ctgtcgggcg tggtctacag cgccgccaac      1080
     ggcgtctggc cctcgctcta cggcgagatg ttcgacactc gcgtccggct ctcgggcatg      1140
     gcgatcggca cgcagatcgg cttcgcgctc ggcggcttcg cgcccaccat cgcggctgcg      1200
     atccagggca gcgggccgac gggctggtac ccggtggcgg ctttcgtgac ggtgacctgc      1260
     ctgatttccg ccttctcggt ctatacggcg cgggaaacct accggacgcc cctgcacgcg      1320
     ctcggccgcc gctga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page