(data stored in ACNUC7421 zone)

EMBL: CP001349.PE113

CP001349.PE113       Location/Qualifiers
FT   CDS_pept        complement(124972..125847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0118"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; Shikimate
FT                   dehydrogenase substrate binding domain protein; KEGG:
FT                   rso:RSp1398 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55165"
FT                   /db_xref="GOA:B8IUC0"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC0"
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /protein_id="ACL55165.1"
FT                   /translation="MSAPSRILLGLIGTGIQASRTPPMHEHEGDAQGLRVLYQTIDLER
FT                   LGLGPEALPELLTAAERMGFAGLNITHPCKQAVIPHLDALSPDAAALGAVNTVVLREGR
FT                   RVGHNTDWWGFAESFRRNLPGAALGRVVQLGAGGAGAAVAHALLTLGVQDLAIADVDPT
FT                   RAEQVAEGLCGRFGAGRARASTDLAADMAQADGLAHCTPTGMAAHPGLPLPAELLRPAL
FT                   WVAEIVYFPIETELLRVARGLGCRTLDGGGMAVFQAVEAFRLFTGREPDPARMLRHFAE
FT                   LGDKAAKTAA"
     gtgagcgctc cgtcccgcat cctcctcggc ctcatcggca ccggcatcca ggcctcccgc        60
     actcccccga tgcacgagca cgagggcgat gcccagggcc tgcgcgtcct ctatcagacg       120
     atcgatctgg agcggctcgg cctcggcccg gaggcgctgc cggagctgct caccgccgcc       180
     gagcgcatgg gctttgccgg cctcaacatc acgcatccct gcaagcaggc ggtgatcccc       240
     catctcgacg cgctctcgcc cgacgcggcg gccctcgggg ctgtcaacac ggtggtgctg       300
     cgggagggca ggcgggtcgg ccacaacacc gattggtggg gcttcgccga gagcttccgg       360
     cgcaacctgc cgggcgccgc gctcggccgc gtcgtccagc tcggagcggg cggggccggg       420
     gccgcggtcg cgcacgcgct gctgacgctc ggcgttcagg atctcgccat tgcggacgtg       480
     gatcccaccc gggcggagca ggtcgccgag gggctgtgcg gacgcttcgg cgcgggacgc       540
     gcccgggcct cgaccgacct cgccgccgac atggcgcagg ccgacggcct cgcccattgc       600
     acgccgaccg gcatggcggc ccatccgggg ctgccgctgc ccgccgagct gctgcgcccc       660
     gcgctctggg tcgccgagat cgtctatttc cccatcgaga ccgagctgct gcgcgtcgcg       720
     cgcggcctcg gctgccgcac tctcgatggc ggcggcatgg cggtgttcca ggccgtcgag       780
     gccttccggc tcttcactgg gcgcgagccc gatccggcgc ggatgctgcg ccacttcgcc       840
     gaactcggcg acaaggccgc gaagacggcc gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page