(data stored in ACNUC7421 zone)

EMBL: CP001349.PE114

CP001349.PE114       Location/Qualifiers
FT   CDS_pept        126251..127201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_4752 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55166"
FT                   /db_xref="GOA:B8IUC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55166.1"
FT                   /translation="MLTLRQIEVARAVMVTGTLAGAARLLNVSAPGISRLMKYTETSLG
FT                   IRLFDRRGGRMVPSEQARAVFEQINAVFDKVEDLRYVVERTRSGAAQELLIGSVPSISH
FT                   VMVPRAIERVRAKYPQLLIDINILKIEEAIDYLLLGKGEVVAMSYRLEHPALIFEPLAS
FT                   GNLYCIVPEHHALAAHESISAREIVKHPLIGIDPNDPYGRIMSDIFRARDLAYEITIRA
FT                   RFGSTVCSLVKAGLGIAVIDQFTIADGAFPGIRVLRIEEPTRFQTWIARKAGSTLSLFA
FT                   ESFVKDLRQEMTRQADMSPRAVARRAERISGQIIT"
     atgctgacgc tacgccaaat cgaggtggcc cgggccgtga tggtgacggg aacgctggcg        60
     ggagccgccc ggctcctcaa cgtctcggcg ccgggcatca gccgcctcat gaaatatacc       120
     gagacctccc tcggcattcg gctgttcgac cgccgtggcg gccgcatggt gccatccgag       180
     caggcgcggg ccgtgttcga acagatcaat gcggtcttcg acaaggtcga ggatctccgc       240
     tacgtcgtgg agcgcacgcg gagcggcgcc gctcaggaac tcctgatcgg ctcggtgcca       300
     tcgatctccc acgtcatggt gccgcgggcg atcgagcgcg ttcgcgccaa gtatccgcag       360
     ctcctcatcg acatcaacat cctgaagatc gaggaggcca tcgactatct cctcctcggc       420
     aagggcgagg ttgtcgcgat gagctatcgc ctcgaacacc cggccctgat cttcgagcca       480
     ctcgcgagcg gcaacctgta ctgcatcgtg ccggaacatc acgcgctcgc ggcccatgag       540
     tcgatctcgg cgcgcgagat cgtgaagcat ccgctcatcg gaatcgaccc gaatgatccg       600
     tatgggcgca tcatgtcgga catcttccgc gcgcgcgatc tcgcctacga gatcaccatc       660
     cgggcgcggt tcggctcgac cgtctgctct ctcgtgaagg ccggcctcgg catcgccgtc       720
     atcgatcagt tcaccatcgc cgacggcgcc tttccgggca ttcgcgtcct gcgcatcgag       780
     gagccgaccc gcttccagac ctggatcgcc cgcaaggccg gcagcacgct cagcctgttt       840
     gccgagagct tcgtcaagga ccttcggcag gagatgacgc ggcaggccga tatgtccccc       900
     agggcggtgg cccggcgggc tgagcgcatt tccggacaaa tcataacatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page