(data stored in ACNUC7421 zone)

EMBL: CP001349.PE115

CP001349.PE115       Location/Qualifiers
FT   CDS_pept        127329..128219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0120"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: met:M446_4753
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55167"
FT                   /db_xref="GOA:B8IUC2"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC2"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACL55167.1"
FT                   /translation="MAPVQQQRFLLGLIGSPIKHSASPAMHEAAARALGMRAHYQLIDV
FT                   AGAGPALLRTLLDGLRLIGFAGANVTFPYKEAVVPLLDDLSEGARAVGAVNTIVVEDGR
FT                   LVGHNTDASGFARALTQRFGPAPRGPVALIGAGGVGKAIAVALSGFPGLEIRLVDRDPA
FT                   KAASLAAALAPRAALRVCGTVEQALDGAGGLVNGTPVGMLPNRGSPVPPHLLRPEIWVA
FT                   DAVYSPLWTPLLREAARLGAPTMTGRDLAIHQAVDAFRLFTGVDAPETAMAQAFDAAIA
FT                   AHAEEGSPPPPRSDG"
     atggccccgg tacagcagca gcgcttcctg ctcggattga tcgggtcacc gatcaagcat        60
     tcggcctcgc cggcgatgca cgaggcggcg gcgcgcgccc tcggcatgcg ggcgcattac       120
     cagctcatcg acgtcgccgg agcgggcccg gcgctgctcc gcacgctcct cgacgggctg       180
     cgcctgatcg ggttcgcggg cgcgaacgtc acctttccct acaaggaggc ggtggttccg       240
     ctcctcgacg atctgtccga gggcgcgcgg gcggtgggcg ccgtgaacac gatcgtggtc       300
     gaggacggcc gtctcgtcgg ccacaacacc gatgccagcg gctttgcccg cgccctgacg       360
     cagaggttcg gaccggctcc gcgcggcccc gtcgcgctga tcggcgccgg cggcgtcggg       420
     aaggccatcg cggtggcgct cagcgggttc cccgggcttg agatccgcct cgtcgatcgc       480
     gatccggcca aggccgcctc cctcgccgcc gcgctcgcac cccgcgcggc tttgcgcgtc       540
     tgcggaacgg tcgagcaggc gctcgacggt gcgggcggcc tcgtcaacgg gacgccggtc       600
     gggatgctgc cgaaccgcgg cagtccggtt ccgccgcacc tcctccggcc cgagatctgg       660
     gtcgcggacg cggtgtattc gccgctgtgg acgccgctcc tccgggaggc ggcgcgcctg       720
     ggcgccccga ccatgaccgg acgcgatctc gccatccacc aggcggtcga cgcgttccgg       780
     ctgttcacgg gcgtggacgc acccgagacc gcgatggcgc aggccttcga cgccgcgatt       840
     gcggcccatg cggaggaagg cagccccccg ccgccgcgga gcgacggatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page